KEGG   Macaca mulatta (rhesus monkey): 709776Help
Entry
709776            CDS       T01028                                 

Gene name
OGDHL
Definition
(RefSeq) oxoglutarate dehydrogenase-like
  KO
K00164  2-oxoglutarate dehydrogenase E1 component [EC:1.2.4.2]
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc00020  Citrate cycle (TCA cycle)
mcc00310  Lysine degradation
mcc00380  Tryptophan metabolism
mcc01100  Metabolic pathways
mcc01200  Carbon metabolism
Module
mcc_M00009  Citrate cycle (TCA cycle, Krebs cycle)
mcc_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
mcc_M00032  Lysine degradation, lysine => saccharopine => acetoacetyl-CoA
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    709776 (OGDHL)
  09105 Amino acid metabolism
   00310 Lysine degradation
    709776 (OGDHL)
   00380 Tryptophan metabolism
    709776 (OGDHL)
Enzymes [BR:mcc01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.2  oxoglutarate dehydrogenase (succinyl-transferring)
     709776 (OGDHL)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: E1_dh Transket_pyr OxoGdeHyase_C 2-oxogl_dehyd_N
Motif
Other DBs
NCBI-GeneID: 709776
NCBI-ProteinID: NP_001252731
Ensembl: ENSMMUG00000000275
UniProt: I2CYQ6
LinkDB All DBs
Position
9
AA seq 1010 aa AA seqDB search
MNQLRLLPSRLGAQAVRLLAAHEVPVFGWRSRSSGPPATLPSSKDGGSSSYMEEMYFAWL
ENPRSVHKSWDNFFRKASEEASSGSAQPRPPSVVRDSRSAVSSRTKTSKLVEDHLAVQSL
IRAYQIRGHHVAQLDPLGILDADLDSFVPSDLITTIDKLAFYDLQEADLDKEFQLPTTTF
IGGSENTLSLREIIRRLENTYCQHIGLEFMFINDVEQCQWIRQKFETPGVMQFSSEEKRT
LLARLVRSMRFEDFLARKWSSEKRFGLEGCEVMIPALKTIIDKSSEMGIENVILGMPHRG
RLNVLANVIRKDLEQIFCQFDPKLEAADEGSGDVKYHLGMYHERINRVTNRNITLSLVAN
PSHLEAVDPVVQGKTKAEQFYRGDAQGKKVMSILVHGDAAFAGQGVVYETFHLSDLPSYT
TNGTVHVVVNNQIGFTTDPRMARSSPYPTDVARVVNAPIFHVNADDPEAVIYVCSVAAEW
RNTFNKDVVVDLVCYRRRGHNEMDEPMFTQPLMYKQIHRQVPVLKKYADKLIAEGTVTLQ
EFEEEIAKYDRICEEAYGRSKDKKILHIKHWLDSPWPGFFNVDGEPKSMTCPATGIPEDV
LTHIGSVASSVPLEDFKIHTGLSRILRGRADMTKNRTVDWALAEYMAFGSLLKEGIHVRL
SGQDVERGTFSHRHHVLHDQEVDRRTCVPMNHLWPDQAPYTVCNSSLSEYGVLGFELGYA
MASPNALVLWEAQFGDFHNTAQCIIDQFISTGQAKWVRHNGIVLLLPHGMEGMGPEHSSA
RPERFLQMSNDDSDAYPAFTKDFEVSQLYDCNWIVVNCSTPANYFHVLRRQILLPFRKPL
IIFTPKSLLRHPEAKSSFDQMVSGTSFQRVIPEDGAAAQAPEQVQRLIFCTGKVYYDLVK
ERSSQGLEEKVAITRLEQISPFPFDLIKQEAEKYPGAELAWCQEEHKNMGYYDYISPRFM
TILRRTRPIWYVGRDPAAAPATGNRNTHLVSLKKFLDTAFNLQAFEGKTF
NT seq 3033 nt NT seq  +upstreamnt  +downstreamnt
atgaatcagctgaggctgttgccatcccgtcttggggcacaggctgtgaggcttctggcc
gcacatgaagtcccagtgtttggctggcgcagcaggtcctccgggccaccggccaccctc
ccaagcagcaaagatggaggcagctccagttacatggaggagatgtacttcgcctggttg
gaaaacccccggagtgtccacaagtcctgggacaacttcttccggaaagccagtgaggaa
gcctcttctggctctgctcagccacggcccccttctgttgtccgtgacagcaggtctgca
gtctcaagccggaccaagaccagcaagttagtggaggaccacctggctgtgcagtccctg
atccgggcctaccagatccgtggtcaccatgtggcccagctggaccccctgggcattcta
gatgcagacctggactcctttgtgccctcagacttgatcacaaccattgataaactggcc
ttctatgacctgcaggaggctgaccttgataaggagttccagctgccaacgaccaccttc
atcgggggctctgaaaacaccctctctcttcgggagatcattcgacgcctggagaacact
tactgccagcacattggcctggagttcatgttcatcaacgatgtggagcagtgccagtgg
atccggcagaagtttgagacccctggtgtgatgcagttctccagcgaggagaagcggaca
ctactggcccggctggtgcgctccatgaggtttgaagacttcctggcccggaagtggtcc
tcagagaagcggtttggcctggagggctgcgaagtgatgattcctgccctcaagaccatc
atcgacaaatccagcgagatggggatcgagaatgtcatcttggggatgccacacaggggc
aggctgaacgtgctggccaacgtgatccgcaaggacctggagcagatcttctgccagttt
gaccccaagctggaggcggcagacgagggctccggggacgtcaagtaccacctgggcatg
taccacgagaggatcaaccgtgtcaccaaccggaacatcactctgtcgctggtcgccaac
ccctcccacctggaggcagtggaccctgtggtgcaggggaagacaaaggcagagcagttc
taccgtggagacgcccagggcaagaaggtcatgtccatcctggttcatggggacgccgcc
tttgctggccagggcgtggtatatgagaccttccacctgagcgacctgccctcctacaca
accaacggtaccgtgcacgtcgtcgtcaacaaccagattggattcaccacagacccccga
atggcccgttcctcaccataccccaccgacgtggcccgggtggtcaatgcgcccatcttc
cacgtgaacgccgatgacccagaggctgtgatatatgtgtgcagtgtggcagccgaatgg
agaaacactttcaacaaagatgttgtcgtggacctggtctgttaccgccggcgcggccac
aatgaaatggacgagcccatgttcacccagccgctcatgtacaagcagatccacagacag
gtgcctgtgctgaagaagtacgcagacaagctgattgccgagggcacggtcaccctgcag
gagtttgaggaagaaattgcgaaatacgaccggatctgtgaggaggcttatggcaggtcc
aaggataaaaagatcctgcatataaagcactggttggactccccctggcccggcttcttc
aacgtagatggggagcccaagagcatgacatgcccagccacggggatccctgaggacgtg
ctcacccacatcggcagcgtggccagctctgtgcccctggaggactttaagatccacacc
ggcctctctcgcattctgcggggccgggcggacatgaccaagaaccggacggtggactgg
gcgttggcagagtacatggcctttggctccctgctgaaggagggcatccacgtgcggctc
agcgggcaggatgtggagaggggcacgttcagtcaccggcaccacgttctccatgaccag
gaggttgaccgcaggacgtgtgtgcctatgaatcatctctggcctgaccaggccccgtac
accgtgtgcaacagctccctctcggagtacggagtcctgggctttgagctgggctatgcc
atggccagccccaatgccctggtcctctgggaggcccagtttggggacttccacaacacg
gcccagtgcatcatcgaccagttcatcagcaccggccaggccaagtgggtgcggcataac
ggcattgtgctgctgctgccccatggcatggaaggcatgggcccagagcactcgtctgcg
aggcccgagaggttcctgcagatgagcaatgatgactcggatgcctaccccgcattcacc
aaggacttcgaggtgagtcagctctatgactgcaactggatcgtggtcaactgctccaca
ccggccaactacttccacgtgctgcgccggcagatcctgctgcctttccgcaagccgctg
attatcttcacacctaaatctctgctgaggcacccagaggccaagtccagctttgaccaa
atggtatccgggaccagcttccagcgggtgattcctgaagatggggctgcagcacaggcc
cctgagcaggtgcagcggctcatcttctgcacgggaaaggtgtactatgacttggtgaag
gagcggagcagccagggcctggaggagaaggtggccatcacgcgcctggagcagatctct
ccattcccctttgacctgatcaagcaggaggcagagaagtacccaggtgcggagctggcc
tggtgtcaggaggagcacaagaacatgggctactatgactacatcagcccacgcttcatg
accatcctgaggcgcacgcggcccatatggtatgtcggccgggacccagcggctgcacca
gccacaggaaacaggaacactcacttggtgtcactgaagaagtttctggatactgccttc
aatctccaggcctttgagggcaagacattttag

DBGET integrated database retrieval system