KEGG   Macaca mulatta (rhesus monkey): 709988
Entry
709988            CDS       T01028                                 

Definition
(RefSeq) cyclin-dependent kinase inhibitor 2A
  KO
K06621  cyclin-dependent kinase inhibitor 2A
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc01522  Endocrine resistance
mcc01524  Platinum drug resistance
mcc04110  Cell cycle
mcc04115  p53 signaling pathway
mcc04218  Cellular senescence
mcc04934  Cushing syndrome
mcc05163  Human cytomegalovirus infection
mcc05166  Human T-cell leukemia virus 1 infection
mcc05200  Pathways in cancer
mcc05203  Viral carcinogenesis
mcc05206  MicroRNAs in cancer
mcc05212  Pancreatic cancer
mcc05214  Glioma
mcc05218  Melanoma
mcc05219  Bladder cancer
mcc05220  Chronic myeloid leukemia
mcc05223  Non-small cell lung cancer
mcc05225  Hepatocellular carcinoma
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    709988
   04115 p53 signaling pathway
    709988
   04218 Cellular senescence
    709988
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    709988
   05206 MicroRNAs in cancer
    709988
   05203 Viral carcinogenesis
    709988
  09162 Cancer: specific types
   05212 Pancreatic cancer
    709988
   05225 Hepatocellular carcinoma
    709988
   05214 Glioma
    709988
   05220 Chronic myeloid leukemia
    709988
   05218 Melanoma
    709988
   05219 Bladder cancer
    709988
   05223 Non-small cell lung cancer
    709988
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    709988
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    709988
   05163 Human cytomegalovirus infection
    709988
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    709988
   01522 Endocrine resistance
    709988
SSDB
Motif
Pfam: Ank_4 Ank_5 Ank_2 Ank DUF2384
Other DBs
NCBI-GeneID: 709988
NCBI-ProteinID: XP_028690959
Ensembl: ENSMMUG00000001134
LinkDB
Position
15
AA seq 148 aa
MEPSADWLATAAARGRVEEVRALLEAGALPNAPNSYGRRPIQVMMMGSARVAELLLLHGA
EPNCADPATLTRPVHDAAREGFLDTLAVLHRAGARLDVHDAWGRLPVDLAEERGHRDVAR
YLRAAAGGTRGSSHARIDAAEGPSGIPD
NT seq 447 nt   +upstreamnt  +downstreamnt
atggagccttcggcggactggctggccacggctgcggcccggggtcgggtagaggaggtg
cgggcgctgctcgaggcgggggcgctgcccaacgcaccgaatagttacggtcggaggccg
atccaggtcatgatgatgggcagcgcccgcgtggcggagctgctgctgctccacggcgca
gagcccaactgcgccgaccccgccactctcacccgacccgtgcacgacgctgcccgggag
ggcttcctggacacgctggcggtgctgcaccgggctggggcgcggctggacgtacacgat
gcctggggccgtctgcccgtggacctggctgaggagcggggccatcgcgatgtcgcacgg
tacctgcgcgcggctgcggggggcaccagaggcagtagccatgcccgcatagatgccgcg
gaaggtccctcaggcatccccgattga

DBGET integrated database retrieval system