KEGG   Macaca mulatta (rhesus monkey): 710200
Entry
710200            CDS       T01028                                 

Gene name
E2F2
Definition
(RefSeq) transcription factor E2F2
  KO
K09389  transcription factor E2F2
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc01522  Endocrine resistance
mcc04110  Cell cycle
mcc04218  Cellular senescence
mcc04934  Cushing syndrome
mcc05160  Hepatitis C
mcc05161  Hepatitis B
mcc05163  Human cytomegalovirus infection
mcc05166  Human T-cell leukemia virus 1 infection
mcc05167  Kaposi sarcoma-associated herpesvirus infection
mcc05169  Epstein-Barr virus infection
mcc05200  Pathways in cancer
mcc05206  MicroRNAs in cancer
mcc05212  Pancreatic cancer
mcc05214  Glioma
mcc05215  Prostate cancer
mcc05218  Melanoma
mcc05219  Bladder cancer
mcc05220  Chronic myeloid leukemia
mcc05222  Small cell lung cancer
mcc05223  Non-small cell lung cancer
mcc05224  Breast cancer
mcc05225  Hepatocellular carcinoma
mcc05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    710200 (E2F2)
   04218 Cellular senescence
    710200 (E2F2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    710200 (E2F2)
   05206 MicroRNAs in cancer
    710200 (E2F2)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    710200 (E2F2)
   05225 Hepatocellular carcinoma
    710200 (E2F2)
   05226 Gastric cancer
    710200 (E2F2)
   05214 Glioma
    710200 (E2F2)
   05220 Chronic myeloid leukemia
    710200 (E2F2)
   05218 Melanoma
    710200 (E2F2)
   05219 Bladder cancer
    710200 (E2F2)
   05215 Prostate cancer
    710200 (E2F2)
   05224 Breast cancer
    710200 (E2F2)
   05222 Small cell lung cancer
    710200 (E2F2)
   05223 Non-small cell lung cancer
    710200 (E2F2)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    710200 (E2F2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    710200 (E2F2)
   05161 Hepatitis B
    710200 (E2F2)
   05160 Hepatitis C
    710200 (E2F2)
   05163 Human cytomegalovirus infection
    710200 (E2F2)
   05167 Kaposi sarcoma-associated herpesvirus infection
    710200 (E2F2)
   05169 Epstein-Barr virus infection
    710200 (E2F2)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    710200 (E2F2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mcc03000]
    710200 (E2F2)
Transcription factors [BR:mcc03000]
 Eukaryotic type
  Helix-turn-helix
   Fork head/winged helix cell cycle-controlling factors, E2F
    710200 (E2F2)
SSDB
Motif
Pfam: E2F_CC-MB E2F_TDP
Other DBs
NCBI-GeneID: 710200
NCBI-ProteinID: XP_001102839
Ensembl: ENSMMUG00000011832
UniProt: F7H757
LinkDB
Position
1
AA seq 437 aa
MLQGPRALVSAAGQPPKVVPAMSPTELWPSGLSSPQLCPATTTYYTPLYPQTAPPAVAPG
TCLDATPHGPEGQVVRCLPAGRLPAKRKLDLEGIGRPAVPEFPTPKGKCIRVDGLPSPKT
PKSPGEKTRYDTSLGLLTKKFIYLLSESEDGVLDLNWAAEVLDVQKRRIYDITNVLEGIQ
LIRKKAKNNIQWVGRGMFEDPTRPGKQQQLGQELKELMNIEEALDQLIQSCSLSFKHLTE
DKANKRLAYVTYQDIRAVGNFKEQTVIAVKAPPQTRLEVPDRTEDNLQIYLKSTQGPIEV
YLCPEEVQEPDSPSEEPLPSTSTLCPSPDSAQPSSSTDPSIMEPTASSVPAPAPTPQQAP
PPPSLVPLEATDSMLELPHPLLQQTEDQFLSPTLACSSPLISFSPSLDQDDYLWGLEAGE
GISDLFDSYDLGDLLIN
NT seq 1314 nt   +upstreamnt  +downstreamnt
atgctgcaagggccccgggccttggtttcggccgctgggcagcccccgaaggtggtgccc
gcgatgagccccacagagctgtggccatccggcctcagcagcccccagctctgcccagct
actaccacctactacacgccgctgtacccgcagacggcgcctcccgcagtggcgcccggc
acctgcctcgatgccactccccacggacccgagggccaagttgttcgatgcctgccggca
ggccggctgccggccaaaaggaagctggatctggaggggattgggaggcctgccgtccct
gagttcccaacccccaaggggaagtgcatcagagtggatggcctccccagccccaaaacc
cccaaatcccccggggagaagactcggtatgacacctcgctggggctgctcaccaagaag
ttcatttacctcctgagcgagtcagaggatggggtcctggacctgaactgggccgctgag
gtgctggacgtgcagaagcggcgcatctatgacatcaccaacgtgctggagggcatccag
ctcatccgcaagaaggccaagaacaacatccagtgggtaggcaggggaatgtttgaagac
cccacccggcctgggaagcagcaacagctggggcaggagctgaaggagctgatgaacatc
gaggaggccttggaccagctcatccagagctgctctctgagcttcaagcacctgactgag
gacaaggccaacaagaggctggcctatgtgacttaccaggatatccgtgctgtcggcaac
tttaaggagcaaacagtgattgccgtcaaggcccctccgcagacaagactggaagtgccc
gacaggactgaggacaacctgcagatatatctcaagagcacccaagggcccatcgaagtc
tacctgtgcccagaggaggtgcaggagccggacagtccttccgaggagcccctcccctct
acctccaccctctgccccagccctgactctgcccagcccagcagcagcaccgaccctagc
atcatggagcccacagcatcctcagtgccagcgccagcgccaaccccccagcaggcccca
ccgcctccatccctggtccccttggaggctactgacagcatgctggagctgccgcaccca
ctcctgcagcagactgaggaccagttcctgtccccgaccctggcatgcagctcccctctg
atcagcttctccccgtccttggaccaggacgactacctgtggggcttggaggcgggtgag
ggcatcagcgacctcttcgactcctacgacctcggggacctgttgattaattga

KEGG   Macaca mulatta (rhesus monkey): 713904
Entry
713904            CDS       T01028                                 

Gene name
E2F3
Definition
(RefSeq) transcription factor E2F3 isoform X1
  KO
K06620  transcription factor E2F3
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc01522  Endocrine resistance
mcc04110  Cell cycle
mcc04218  Cellular senescence
mcc04934  Cushing syndrome
mcc05160  Hepatitis C
mcc05161  Hepatitis B
mcc05163  Human cytomegalovirus infection
mcc05166  Human T-cell leukemia virus 1 infection
mcc05167  Kaposi sarcoma-associated herpesvirus infection
mcc05169  Epstein-Barr virus infection
mcc05200  Pathways in cancer
mcc05206  MicroRNAs in cancer
mcc05212  Pancreatic cancer
mcc05214  Glioma
mcc05215  Prostate cancer
mcc05218  Melanoma
mcc05219  Bladder cancer
mcc05220  Chronic myeloid leukemia
mcc05222  Small cell lung cancer
mcc05223  Non-small cell lung cancer
mcc05224  Breast cancer
mcc05225  Hepatocellular carcinoma
mcc05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    713904 (E2F3)
   04218 Cellular senescence
    713904 (E2F3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    713904 (E2F3)
   05206 MicroRNAs in cancer
    713904 (E2F3)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    713904 (E2F3)
   05225 Hepatocellular carcinoma
    713904 (E2F3)
   05226 Gastric cancer
    713904 (E2F3)
   05214 Glioma
    713904 (E2F3)
   05220 Chronic myeloid leukemia
    713904 (E2F3)
   05218 Melanoma
    713904 (E2F3)
   05219 Bladder cancer
    713904 (E2F3)
   05215 Prostate cancer
    713904 (E2F3)
   05224 Breast cancer
    713904 (E2F3)
   05222 Small cell lung cancer
    713904 (E2F3)
   05223 Non-small cell lung cancer
    713904 (E2F3)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    713904 (E2F3)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    713904 (E2F3)
   05161 Hepatitis B
    713904 (E2F3)
   05160 Hepatitis C
    713904 (E2F3)
   05163 Human cytomegalovirus infection
    713904 (E2F3)
   05167 Kaposi sarcoma-associated herpesvirus infection
    713904 (E2F3)
   05169 Epstein-Barr virus infection
    713904 (E2F3)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    713904 (E2F3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mcc03000]
    713904 (E2F3)
Transcription factors [BR:mcc03000]
 Eukaryotic type
  Helix-turn-helix
   Fork head/winged helix cell cycle-controlling factors, E2F
    713904 (E2F3)
SSDB
Motif
Pfam: E2F_CC-MB E2F_TDP
Other DBs
NCBI-GeneID: 713904
NCBI-ProteinID: XP_014991154
Ensembl: ENSMMUG00000017649
LinkDB
Position
4
AA seq 340 aa
MPLQQQAKRRLELGESGHQYLSDGLKTPKGKGRAALRSPDSPKTPKSPSEKTRYDTSLGL
LTKKFIQLLSQSPDGVLDLNKAAEVLKVQKRRIYDITNVLEGIHLIKKKSKNNVQWMGCS
LSEDGGMLAQCQGLSKEVTELSQEEKKLDELIQSCTLDLKLLTEDSENQRLAYVTYQDIR
KISGLKDQTVIVVKAPPETRLEVPDSIESLQIHLASTQGPIEVYLCPEETETHSPMKTNN
QDHNGNIPKPTSKDLASTNSGHSDCSISMGNLSPLASPANLLQQTEDQIPSNLEGPFVNL
LPPLLQEDYLLSLGEEEGISDLFDAYDLEKLPLVEDFMCS
NT seq 1023 nt   +upstreamnt  +downstreamnt
atgcccttacagcagcaggcaaagcgaaggctggagctaggagaaagtggtcatcagtac
ctctcagatggtttaaaaacccccaagggcaaaggaagagctgcactacgaagtccagat
agtccaaaaactccaaaatctccctcagaaaaaacgcggtatgatacgtctcttggtctg
ctcaccaagaagttcattcagctcctgagccagtcacccgatggggtcttggatttgaac
aaggcagcagaagtgctaaaagtgcaaaagagaaggatttatgatatcaccaacgttctg
gaaggcatccacctcattaagaagaagtctaaaaacaacgtccaatggatgggctgcagt
ctgtctgaggatgggggcatgctggcccagtgtcaaggcctgtcaaaagaagtgaccgag
ctcagtcaggaagagaagaaattagatgaactgatccaaagctgcaccctggacctcaaa
ctgttaaccgaggattcagagaatcaaaggttagcttatgttacatatcaagatattcga
aaaattagtggccttaaagaccaaactgttatagttgtgaaagcccctccagaaacaaga
cttgaagtgcctgactcaatagagagcctacaaatacatttggcaagtacccaagggccc
attgaggtttatttatgtccagaagagactgaaacacacagtccaatgaaaacaaacaac
caagaccacaatgggaatatccctaaacccacttccaaagacttggcttcaaccaactca
ggacatagcgattgctcaatttctatgggaaacctttctcctctggcctccccagccaac
ctcttacagcagactgaggaccaaattccttccaacctagaaggaccgtttgtgaactta
ctgcctcccctgctgcaagaggactatctcctgagcctcggggaggaggaaggcatcagc
gatctctttgatgcttacgatttggaaaagctcccactggtggaagacttcatgtgtagt
tga

KEGG   Macaca mulatta (rhesus monkey): 714126
Entry
714126            CDS       T01028                                 

Gene name
E2F1
Definition
(RefSeq) transcription factor E2F1
  KO
K17454  transcription factor E2F1
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc01522  Endocrine resistance
mcc04110  Cell cycle
mcc04137  Mitophagy - animal
mcc04218  Cellular senescence
mcc04934  Cushing syndrome
mcc05160  Hepatitis C
mcc05161  Hepatitis B
mcc05163  Human cytomegalovirus infection
mcc05165  Human papillomavirus infection
mcc05166  Human T-cell leukemia virus 1 infection
mcc05167  Kaposi sarcoma-associated herpesvirus infection
mcc05169  Epstein-Barr virus infection
mcc05200  Pathways in cancer
mcc05206  MicroRNAs in cancer
mcc05212  Pancreatic cancer
mcc05214  Glioma
mcc05215  Prostate cancer
mcc05218  Melanoma
mcc05219  Bladder cancer
mcc05220  Chronic myeloid leukemia
mcc05222  Small cell lung cancer
mcc05223  Non-small cell lung cancer
mcc05224  Breast cancer
mcc05225  Hepatocellular carcinoma
mcc05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    714126 (E2F1)
  09143 Cell growth and death
   04110 Cell cycle
    714126 (E2F1)
   04218 Cellular senescence
    714126 (E2F1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    714126 (E2F1)
   05206 MicroRNAs in cancer
    714126 (E2F1)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    714126 (E2F1)
   05225 Hepatocellular carcinoma
    714126 (E2F1)
   05226 Gastric cancer
    714126 (E2F1)
   05214 Glioma
    714126 (E2F1)
   05220 Chronic myeloid leukemia
    714126 (E2F1)
   05218 Melanoma
    714126 (E2F1)
   05219 Bladder cancer
    714126 (E2F1)
   05215 Prostate cancer
    714126 (E2F1)
   05224 Breast cancer
    714126 (E2F1)
   05222 Small cell lung cancer
    714126 (E2F1)
   05223 Non-small cell lung cancer
    714126 (E2F1)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    714126 (E2F1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    714126 (E2F1)
   05161 Hepatitis B
    714126 (E2F1)
   05160 Hepatitis C
    714126 (E2F1)
   05163 Human cytomegalovirus infection
    714126 (E2F1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    714126 (E2F1)
   05169 Epstein-Barr virus infection
    714126 (E2F1)
   05165 Human papillomavirus infection
    714126 (E2F1)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    714126 (E2F1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mcc03000]
    714126 (E2F1)
Transcription factors [BR:mcc03000]
 Eukaryotic type
  Helix-turn-helix
   Fork head/winged helix cell cycle-controlling factors, E2F
    714126 (E2F1)
SSDB
Motif
Pfam: E2F_CC-MB E2F_TDP TP1
Other DBs
NCBI-GeneID: 714126
NCBI-ProteinID: XP_001103717
Ensembl: ENSMMUG00000023550
UniProt: F7DEJ9
LinkDB
Position
10
AA seq 437 aa
MALAGAPAGGPCAPALEALLGAGALRLLDSSQIVIISAAQDASAPPAPTGPAAPAAGPCD
PDLLLFATPQAPRPTPSAPRPALGRPPVKRRLDLETDHQYLAESSGPARGRGRHPGKGVK
SPGEKSRYETSLNLTTKRFLELLSRSADGVVDLNWAAEVLKVQKRRIYDITNVLEGIQLI
AKKSKNHIQWLGSHTTVGVSGRLEGLTEDLRQLQESEQQLDHLMNICTTQLRLLSEDTDS
QRLAYVTCQDLRSIADPAEQMVMVIKAPPETQLQAVDSSETFQISLKSKQGPIDVFLCPE
ETVGGISPGKTPSQEATSEEENRATDSATIVSPPPSSPPSSLTTDPSQSLLSLEQEPLLS
RMGSLRAPVDEDRLSPLVAADSLLEHVREDFSGLLPEEFISLSPPHEALDYHFGLEEGEG
IRDLFDCDFGDLTPLDF
NT seq 1314 nt   +upstreamnt  +downstreamnt
atggccttggccggggcccctgcgggcggcccatgcgcgccggcgctggaggccctgctc
ggggccggcgcgctgcggctgctcgactcctcgcagatcgtcatcatctctgccgcgcag
gacgccagcgccccgccggctcccaccggccccgcggcgccagccgccggcccctgcgac
cctgacctgctgctcttcgccacaccgcaggcgccccggcccacacccagtgcgccgcgc
cccgcgctcggccgcccgccggtgaagcggaggctggacctggaaactgaccatcagtac
ctggcggagagcagtgggccagctcggggcagaggccgccatccaggaaaaggtgtgaaa
tccccgggggagaagtcacgctatgagacctcactgaatctgaccaccaagcgcttcctg
gagctgctgagccgctcggccgacggtgtcgtcgacctgaactgggctgctgaggtgctg
aaagtgcagaaacggcgcatctatgacatcaccaacgtcctcgagggcatccagctcatt
gccaagaagtccaagaaccacatccagtggctgggtagccacaccacagtgggcgtcagc
gggcggcttgaggggttgaccgaggacctccggcagctgcaggagagcgagcagcagctg
gaccacctgatgaatatctgtactacgcagctgcgcctgctctccgaggatactgacagc
cagcgcctggcctatgtgacgtgtcaggaccttcgtagcattgcagaccctgcagagcag
atggttatggtgatcaaagcccctcccgagacccagctccaagccgtggactcttcggag
acctttcagatctcccttaagagcaaacaaggccccatcgatgttttcctgtgccctgag
gagaccgtgggtgggatcagccctgggaagaccccgtcccaggaggccacttctgaggag
gagaacagggccactgactctgccaccatagtgtcaccaccaccatcatctcccccctca
tccctcaccacagatcccagccagtctctactcagcctggagcaagaaccgctgttgtcc
cggatgggcagcctgcgggctcccgtggacgaggaccgcctgtccccgctggtggcggcc
gactcgctcctggagcatgtgcgggaggacttctccggcctcctccctgaggagttcatc
agcctttccccaccccacgaggccctcgactaccacttcggcctcgaggagggcgagggc
atcagagacctcttcgactgtgactttggggacctcacccccctggatttctga

DBGET integrated database retrieval system