KEGG   Macaca mulatta (rhesus monkey): 710415
Entry
710415            CDS       T01028                                 

Gene name
MAP2K1
Definition
(RefSeq) dual specificity mitogen-activated protein kinase kinase 1
  KO
K04368  mitogen-activated protein kinase kinase 1 [EC:2.7.12.2]
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc01521  EGFR tyrosine kinase inhibitor resistance
mcc01522  Endocrine resistance
mcc04010  MAPK signaling pathway
mcc04012  ErbB signaling pathway
mcc04014  Ras signaling pathway
mcc04015  Rap1 signaling pathway
mcc04022  cGMP-PKG signaling pathway
mcc04024  cAMP signaling pathway
mcc04062  Chemokine signaling pathway
mcc04066  HIF-1 signaling pathway
mcc04068  FoxO signaling pathway
mcc04071  Sphingolipid signaling pathway
mcc04072  Phospholipase D signaling pathway
mcc04114  Oocyte meiosis
mcc04140  Autophagy - animal
mcc04150  mTOR signaling pathway
mcc04151  PI3K-Akt signaling pathway
mcc04210  Apoptosis
mcc04218  Cellular senescence
mcc04270  Vascular smooth muscle contraction
mcc04370  VEGF signaling pathway
mcc04371  Apelin signaling pathway
mcc04380  Osteoclast differentiation
mcc04510  Focal adhesion
mcc04540  Gap junction
mcc04550  Signaling pathways regulating pluripotency of stem cells
mcc04613  Neutrophil extracellular trap formation
mcc04620  Toll-like receptor signaling pathway
mcc04650  Natural killer cell mediated cytotoxicity
mcc04660  T cell receptor signaling pathway
mcc04662  B cell receptor signaling pathway
mcc04664  Fc epsilon RI signaling pathway
mcc04666  Fc gamma R-mediated phagocytosis
mcc04668  TNF signaling pathway
mcc04720  Long-term potentiation
mcc04722  Neurotrophin signaling pathway
mcc04725  Cholinergic synapse
mcc04726  Serotonergic synapse
mcc04730  Long-term depression
mcc04810  Regulation of actin cytoskeleton
mcc04910  Insulin signaling pathway
mcc04912  GnRH signaling pathway
mcc04914  Progesterone-mediated oocyte maturation
mcc04915  Estrogen signaling pathway
mcc04916  Melanogenesis
mcc04917  Prolactin signaling pathway
mcc04919  Thyroid hormone signaling pathway
mcc04921  Oxytocin signaling pathway
mcc04926  Relaxin signaling pathway
mcc04928  Parathyroid hormone synthesis, secretion and action
mcc04929  GnRH secretion
mcc04934  Cushing syndrome
mcc04935  Growth hormone synthesis, secretion and action
mcc05010  Alzheimer disease
mcc05022  Pathways of neurodegeneration - multiple diseases
mcc05034  Alcoholism
mcc05132  Salmonella infection
mcc05135  Yersinia infection
mcc05160  Hepatitis C
mcc05161  Hepatitis B
mcc05163  Human cytomegalovirus infection
mcc05164  Influenza A
mcc05165  Human papillomavirus infection
mcc05166  Human T-cell leukemia virus 1 infection
mcc05167  Kaposi sarcoma-associated herpesvirus infection
mcc05170  Human immunodeficiency virus 1 infection
mcc05200  Pathways in cancer
mcc05205  Proteoglycans in cancer
mcc05206  MicroRNAs in cancer
mcc05210  Colorectal cancer
mcc05211  Renal cell carcinoma
mcc05212  Pancreatic cancer
mcc05213  Endometrial cancer
mcc05214  Glioma
mcc05215  Prostate cancer
mcc05216  Thyroid cancer
mcc05218  Melanoma
mcc05219  Bladder cancer
mcc05220  Chronic myeloid leukemia
mcc05221  Acute myeloid leukemia
mcc05223  Non-small cell lung cancer
mcc05224  Breast cancer
mcc05225  Hepatocellular carcinoma
mcc05226  Gastric cancer
mcc05230  Central carbon metabolism in cancer
mcc05231  Choline metabolism in cancer
mcc05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    710415 (MAP2K1)
   04012 ErbB signaling pathway
    710415 (MAP2K1)
   04014 Ras signaling pathway
    710415 (MAP2K1)
   04015 Rap1 signaling pathway
    710415 (MAP2K1)
   04370 VEGF signaling pathway
    710415 (MAP2K1)
   04371 Apelin signaling pathway
    710415 (MAP2K1)
   04668 TNF signaling pathway
    710415 (MAP2K1)
   04066 HIF-1 signaling pathway
    710415 (MAP2K1)
   04068 FoxO signaling pathway
    710415 (MAP2K1)
   04072 Phospholipase D signaling pathway
    710415 (MAP2K1)
   04071 Sphingolipid signaling pathway
    710415 (MAP2K1)
   04024 cAMP signaling pathway
    710415 (MAP2K1)
   04022 cGMP-PKG signaling pathway
    710415 (MAP2K1)
   04151 PI3K-Akt signaling pathway
    710415 (MAP2K1)
   04150 mTOR signaling pathway
    710415 (MAP2K1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    710415 (MAP2K1)
  09143 Cell growth and death
   04114 Oocyte meiosis
    710415 (MAP2K1)
   04210 Apoptosis
    710415 (MAP2K1)
   04218 Cellular senescence
    710415 (MAP2K1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    710415 (MAP2K1)
   04540 Gap junction
    710415 (MAP2K1)
   04550 Signaling pathways regulating pluripotency of stem cells
    710415 (MAP2K1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    710415 (MAP2K1)
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    710415 (MAP2K1)
   04620 Toll-like receptor signaling pathway
    710415 (MAP2K1)
   04650 Natural killer cell mediated cytotoxicity
    710415 (MAP2K1)
   04660 T cell receptor signaling pathway
    710415 (MAP2K1)
   04662 B cell receptor signaling pathway
    710415 (MAP2K1)
   04664 Fc epsilon RI signaling pathway
    710415 (MAP2K1)
   04666 Fc gamma R-mediated phagocytosis
    710415 (MAP2K1)
   04062 Chemokine signaling pathway
    710415 (MAP2K1)
  09152 Endocrine system
   04910 Insulin signaling pathway
    710415 (MAP2K1)
   04929 GnRH secretion
    710415 (MAP2K1)
   04912 GnRH signaling pathway
    710415 (MAP2K1)
   04915 Estrogen signaling pathway
    710415 (MAP2K1)
   04914 Progesterone-mediated oocyte maturation
    710415 (MAP2K1)
   04917 Prolactin signaling pathway
    710415 (MAP2K1)
   04921 Oxytocin signaling pathway
    710415 (MAP2K1)
   04926 Relaxin signaling pathway
    710415 (MAP2K1)
   04935 Growth hormone synthesis, secretion and action
    710415 (MAP2K1)
   04919 Thyroid hormone signaling pathway
    710415 (MAP2K1)
   04928 Parathyroid hormone synthesis, secretion and action
    710415 (MAP2K1)
   04916 Melanogenesis
    710415 (MAP2K1)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    710415 (MAP2K1)
  09156 Nervous system
   04725 Cholinergic synapse
    710415 (MAP2K1)
   04726 Serotonergic synapse
    710415 (MAP2K1)
   04720 Long-term potentiation
    710415 (MAP2K1)
   04730 Long-term depression
    710415 (MAP2K1)
   04722 Neurotrophin signaling pathway
    710415 (MAP2K1)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    710415 (MAP2K1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    710415 (MAP2K1)
   05206 MicroRNAs in cancer
    710415 (MAP2K1)
   05205 Proteoglycans in cancer
    710415 (MAP2K1)
   05230 Central carbon metabolism in cancer
    710415 (MAP2K1)
   05231 Choline metabolism in cancer
    710415 (MAP2K1)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    710415 (MAP2K1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    710415 (MAP2K1)
   05212 Pancreatic cancer
    710415 (MAP2K1)
   05225 Hepatocellular carcinoma
    710415 (MAP2K1)
   05226 Gastric cancer
    710415 (MAP2K1)
   05214 Glioma
    710415 (MAP2K1)
   05216 Thyroid cancer
    710415 (MAP2K1)
   05221 Acute myeloid leukemia
    710415 (MAP2K1)
   05220 Chronic myeloid leukemia
    710415 (MAP2K1)
   05218 Melanoma
    710415 (MAP2K1)
   05211 Renal cell carcinoma
    710415 (MAP2K1)
   05219 Bladder cancer
    710415 (MAP2K1)
   05215 Prostate cancer
    710415 (MAP2K1)
   05213 Endometrial cancer
    710415 (MAP2K1)
   05224 Breast cancer
    710415 (MAP2K1)
   05223 Non-small cell lung cancer
    710415 (MAP2K1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    710415 (MAP2K1)
   05022 Pathways of neurodegeneration - multiple diseases
    710415 (MAP2K1)
  09165 Substance dependence
   05034 Alcoholism
    710415 (MAP2K1)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    710415 (MAP2K1)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    710415 (MAP2K1)
   05135 Yersinia infection
    710415 (MAP2K1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    710415 (MAP2K1)
   05170 Human immunodeficiency virus 1 infection
    710415 (MAP2K1)
   05161 Hepatitis B
    710415 (MAP2K1)
   05160 Hepatitis C
    710415 (MAP2K1)
   05164 Influenza A
    710415 (MAP2K1)
   05163 Human cytomegalovirus infection
    710415 (MAP2K1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    710415 (MAP2K1)
   05165 Human papillomavirus infection
    710415 (MAP2K1)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    710415 (MAP2K1)
   01522 Endocrine resistance
    710415 (MAP2K1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mcc01001]
    710415 (MAP2K1)
Enzymes [BR:mcc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     710415 (MAP2K1)
Protein kinases [BR:mcc01001]
 Serine/threonine kinases: STE group
  STE7 family
   710415 (MAP2K1)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Pkinase_fungal Kinase-like Seadorna_VP7 NAD_binding_6
Other DBs
NCBI-GeneID: 710415
NCBI-ProteinID: NP_001244478
Ensembl: ENSMMUG00000016840
UniProt: F7C389 G7MXV7
LinkDB
Position
7
AA seq 393 aa
MPKKKPTPIQLNPAPDGSAVNGTSSAETNLEALQKKLEELELDEQQRKRLEAFLTQKQKV
GELKDDDFEKISELGAGNGGVVFKVSHKPSGLVMARKLIHLEIKPAIRNQIIRELQVLHE
CNSPYIVGFYGAFYSDGEISICMEHMDGGSLDQVLKKAGRIPEQILGKVSIAVIKGLTYL
REKHKIMHRDVKPSNILVNSRGEIKLCDFGVSGQLIDSMANSFVGTRSYMSPERLQGTHY
SVQSDIWSMGLSLVEMAVGRYPIPPPDAKELELMFGCQVEGDAAETPPRPRTPGRPLSSY
GMDSRPPMAIFELLDYIVNEPPPKLPSGVFSLEFQDFVNKCLIKNPAERADLKQLMVHAF
IKRSDAEEVDFAGWLCSTIGLHQPSTPTHAAGV
NT seq 1182 nt   +upstreamnt  +downstreamnt
atgcccaagaagaagccgacgcccatccagctgaacccggcccccgacggctccgcggtt
aacgggaccagctctgcggagaccaacttggaggccttgcagaagaagctggaggagcta
gagcttgatgagcagcagcgaaagcgccttgaggcctttctcacccagaagcagaaggtg
ggagaactgaaggatgacgactttgagaagatcagtgagctgggggccggcaatggcggt
gtggtgttcaaggtctcccacaagccttctggcctggtcatggccagaaagctaattcat
ctggagatcaaacccgcaatccggaaccagatcataagggaactgcaggtgctgcatgag
tgcaactctccatacatcgtgggcttctatggtgcattctacagtgatggcgagatcagt
atctgcatggagcacatggatggaggttctctggatcaagtcctgaagaaagctggaaga
attcctgaacaaattttaggaaaagttagcattgctgtgataaaaggcctgacatatctg
agggagaagcacaagatcatgcacagagatgtcaagccctccaacatcctagtcaactcc
cgtggggagatcaagctctgtgactttggggtcagcgggcagctcatcgactccatggcc
aactccttcgtgggcacaaggtcctacatgtcgccagaaagactccaggggactcattac
tctgtgcagtcagacatctggagcatgggactctctctggtagagatggcggttgggagg
tatcccatccctcctccagatgccaaggagctagaactgatgtttgggtgccaggtggag
ggagatgcggctgagaccccacctaggccaaggacccccgggaggccccttagctcatat
ggaatggacagccgacctcccatggcaatttttgagttgttggattacatagtcaacgag
cctcctccgaaattgcccagtggagttttcagtctggaatttcaagattttgtgaataaa
tgcttaataaaaaaccccgcagagagagcagatttgaagcaactcatggttcatgctttt
atcaagagatctgatgctgaggaagtggattttgcaggttggctctgctccactatcggc
cttcaccagcccagcacaccaacccatgctgctggcgtctaa

KEGG   Macaca mulatta (rhesus monkey): 721821
Entry
721821            CDS       T01028                                 

Gene name
MAP2K2
Definition
(RefSeq) dual specificity mitogen-activated protein kinase kinase 2 isoform X1
  KO
K04369  mitogen-activated protein kinase kinase 2 [EC:2.7.12.2]
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc01521  EGFR tyrosine kinase inhibitor resistance
mcc01522  Endocrine resistance
mcc04010  MAPK signaling pathway
mcc04012  ErbB signaling pathway
mcc04014  Ras signaling pathway
mcc04015  Rap1 signaling pathway
mcc04022  cGMP-PKG signaling pathway
mcc04024  cAMP signaling pathway
mcc04066  HIF-1 signaling pathway
mcc04068  FoxO signaling pathway
mcc04071  Sphingolipid signaling pathway
mcc04072  Phospholipase D signaling pathway
mcc04140  Autophagy - animal
mcc04150  mTOR signaling pathway
mcc04151  PI3K-Akt signaling pathway
mcc04210  Apoptosis
mcc04218  Cellular senescence
mcc04270  Vascular smooth muscle contraction
mcc04370  VEGF signaling pathway
mcc04371  Apelin signaling pathway
mcc04540  Gap junction
mcc04550  Signaling pathways regulating pluripotency of stem cells
mcc04613  Neutrophil extracellular trap formation
mcc04620  Toll-like receptor signaling pathway
mcc04650  Natural killer cell mediated cytotoxicity
mcc04660  T cell receptor signaling pathway
mcc04662  B cell receptor signaling pathway
mcc04664  Fc epsilon RI signaling pathway
mcc04720  Long-term potentiation
mcc04722  Neurotrophin signaling pathway
mcc04730  Long-term depression
mcc04810  Regulation of actin cytoskeleton
mcc04910  Insulin signaling pathway
mcc04912  GnRH signaling pathway
mcc04915  Estrogen signaling pathway
mcc04916  Melanogenesis
mcc04917  Prolactin signaling pathway
mcc04919  Thyroid hormone signaling pathway
mcc04921  Oxytocin signaling pathway
mcc04926  Relaxin signaling pathway
mcc04929  GnRH secretion
mcc04934  Cushing syndrome
mcc04935  Growth hormone synthesis, secretion and action
mcc05010  Alzheimer disease
mcc05022  Pathways of neurodegeneration - multiple diseases
mcc05132  Salmonella infection
mcc05135  Yersinia infection
mcc05160  Hepatitis C
mcc05161  Hepatitis B
mcc05163  Human cytomegalovirus infection
mcc05164  Influenza A
mcc05165  Human papillomavirus infection
mcc05166  Human T-cell leukemia virus 1 infection
mcc05167  Kaposi sarcoma-associated herpesvirus infection
mcc05170  Human immunodeficiency virus 1 infection
mcc05200  Pathways in cancer
mcc05205  Proteoglycans in cancer
mcc05206  MicroRNAs in cancer
mcc05210  Colorectal cancer
mcc05211  Renal cell carcinoma
mcc05213  Endometrial cancer
mcc05214  Glioma
mcc05215  Prostate cancer
mcc05216  Thyroid cancer
mcc05218  Melanoma
mcc05219  Bladder cancer
mcc05220  Chronic myeloid leukemia
mcc05221  Acute myeloid leukemia
mcc05223  Non-small cell lung cancer
mcc05224  Breast cancer
mcc05225  Hepatocellular carcinoma
mcc05226  Gastric cancer
mcc05230  Central carbon metabolism in cancer
mcc05231  Choline metabolism in cancer
mcc05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    721821 (MAP2K2)
   04012 ErbB signaling pathway
    721821 (MAP2K2)
   04014 Ras signaling pathway
    721821 (MAP2K2)
   04015 Rap1 signaling pathway
    721821 (MAP2K2)
   04370 VEGF signaling pathway
    721821 (MAP2K2)
   04371 Apelin signaling pathway
    721821 (MAP2K2)
   04066 HIF-1 signaling pathway
    721821 (MAP2K2)
   04068 FoxO signaling pathway
    721821 (MAP2K2)
   04072 Phospholipase D signaling pathway
    721821 (MAP2K2)
   04071 Sphingolipid signaling pathway
    721821 (MAP2K2)
   04024 cAMP signaling pathway
    721821 (MAP2K2)
   04022 cGMP-PKG signaling pathway
    721821 (MAP2K2)
   04151 PI3K-Akt signaling pathway
    721821 (MAP2K2)
   04150 mTOR signaling pathway
    721821 (MAP2K2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    721821 (MAP2K2)
  09143 Cell growth and death
   04210 Apoptosis
    721821 (MAP2K2)
   04218 Cellular senescence
    721821 (MAP2K2)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    721821 (MAP2K2)
   04550 Signaling pathways regulating pluripotency of stem cells
    721821 (MAP2K2)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    721821 (MAP2K2)
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    721821 (MAP2K2)
   04620 Toll-like receptor signaling pathway
    721821 (MAP2K2)
   04650 Natural killer cell mediated cytotoxicity
    721821 (MAP2K2)
   04660 T cell receptor signaling pathway
    721821 (MAP2K2)
   04662 B cell receptor signaling pathway
    721821 (MAP2K2)
   04664 Fc epsilon RI signaling pathway
    721821 (MAP2K2)
  09152 Endocrine system
   04910 Insulin signaling pathway
    721821 (MAP2K2)
   04929 GnRH secretion
    721821 (MAP2K2)
   04912 GnRH signaling pathway
    721821 (MAP2K2)
   04915 Estrogen signaling pathway
    721821 (MAP2K2)
   04917 Prolactin signaling pathway
    721821 (MAP2K2)
   04921 Oxytocin signaling pathway
    721821 (MAP2K2)
   04926 Relaxin signaling pathway
    721821 (MAP2K2)
   04935 Growth hormone synthesis, secretion and action
    721821 (MAP2K2)
   04919 Thyroid hormone signaling pathway
    721821 (MAP2K2)
   04916 Melanogenesis
    721821 (MAP2K2)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    721821 (MAP2K2)
  09156 Nervous system
   04720 Long-term potentiation
    721821 (MAP2K2)
   04730 Long-term depression
    721821 (MAP2K2)
   04722 Neurotrophin signaling pathway
    721821 (MAP2K2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    721821 (MAP2K2)
   05206 MicroRNAs in cancer
    721821 (MAP2K2)
   05205 Proteoglycans in cancer
    721821 (MAP2K2)
   05230 Central carbon metabolism in cancer
    721821 (MAP2K2)
   05231 Choline metabolism in cancer
    721821 (MAP2K2)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    721821 (MAP2K2)
  09162 Cancer: specific types
   05210 Colorectal cancer
    721821 (MAP2K2)
   05225 Hepatocellular carcinoma
    721821 (MAP2K2)
   05226 Gastric cancer
    721821 (MAP2K2)
   05214 Glioma
    721821 (MAP2K2)
   05216 Thyroid cancer
    721821 (MAP2K2)
   05221 Acute myeloid leukemia
    721821 (MAP2K2)
   05220 Chronic myeloid leukemia
    721821 (MAP2K2)
   05218 Melanoma
    721821 (MAP2K2)
   05211 Renal cell carcinoma
    721821 (MAP2K2)
   05219 Bladder cancer
    721821 (MAP2K2)
   05215 Prostate cancer
    721821 (MAP2K2)
   05213 Endometrial cancer
    721821 (MAP2K2)
   05224 Breast cancer
    721821 (MAP2K2)
   05223 Non-small cell lung cancer
    721821 (MAP2K2)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    721821 (MAP2K2)
   05022 Pathways of neurodegeneration - multiple diseases
    721821 (MAP2K2)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    721821 (MAP2K2)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    721821 (MAP2K2)
   05135 Yersinia infection
    721821 (MAP2K2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    721821 (MAP2K2)
   05170 Human immunodeficiency virus 1 infection
    721821 (MAP2K2)
   05161 Hepatitis B
    721821 (MAP2K2)
   05160 Hepatitis C
    721821 (MAP2K2)
   05164 Influenza A
    721821 (MAP2K2)
   05163 Human cytomegalovirus infection
    721821 (MAP2K2)
   05167 Kaposi sarcoma-associated herpesvirus infection
    721821 (MAP2K2)
   05165 Human papillomavirus infection
    721821 (MAP2K2)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    721821 (MAP2K2)
   01522 Endocrine resistance
    721821 (MAP2K2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mcc01001]
    721821 (MAP2K2)
Enzymes [BR:mcc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     721821 (MAP2K2)
Protein kinases [BR:mcc01001]
 Serine/threonine kinases: STE group
  STE7 family
   721821 (MAP2K2)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Pkinase_fungal Kinase-like APH Seadorna_VP7 Kdo CAMSAP_CC1
Other DBs
NCBI-GeneID: 721821
NCBI-ProteinID: XP_014977979
Ensembl: ENSMMUG00000019564
UniProt: H9EUI5
LinkDB
Position
19
AA seq 400 aa
MLARRKPVLPALTINPTIAEGPSPTSEGASEANLVDLQKKLEELELDEQQKKRLEAFLTQ
KAKVGELKDDDFERISELGAGNGGVVTKVQHRPSGLIMARKLIHLEIKPAIRNQIIRELQ
VLHECNSPYIVGFYGAFYSDGEISICMEHMDGGSLDQVLKEAKRIPEEILGKVSIAVLRG
LAYLREKHQIMHRDVKPSNILVNSRGEIKLCDFGVSGQLIDSMANSFVGTRSYMAPERLQ
GTHYSVQSDIWSMGLSLVELAIGRYPIPPPDAKELEAIFGRPVVDGEEGEPHSISPRPRP
PGRPISGHGMDSRPAMAIFELLDYIVNEPPPKLPNGVFTPDFQEFVNKCLIKNPAERADL
KMLTNHTFIKRSEVEEVDFAGWLCKTLRLNQPGTPTRTAV
NT seq 1203 nt   +upstreamnt  +downstreamnt
atgctggcccggaggaagccggtgctgccggcgctcaccatcaaccctaccatcgccgag
ggcccgtcccctaccagcgagggcgcctccgaggcaaacctggtggacctgcagaagaag
ctggaggagctggaacttgacgagcagcagaagaagcgtctggaagcctttctcacccag
aaagccaaggtcggcgaactcaaagacgatgacttcgaaaggatctcagagctgggcgcg
ggcaacggcggggtggtcaccaaagtccagcacagaccctcgggcctcatcatggccagg
aagctgatccaccttgagatcaagccggccatccggaaccagatcatccgcgagctgcag
gtcctgcatgagtgcaactcgccgtacatcgtgggcttctacggggccttctacagcgac
ggggagatcagcatctgcatggagcacatggatggcggctccctggaccaggtgctgaag
gaggccaagaggatccccgaggagatcctggggaaagtcagcattgcggttctccggggc
ttggcgtatctccgagagaagcaccagatcatgcaccgagatgtgaagccctccaacatc
cttgtgaactccagaggggagatcaagctgtgtgacttcggggtgagcggccagctcatc
gactccatggccaactccttcgtgggcacacgctcctacatggctccggagcggttgcag
ggcacacattactcggtgcagtcggacatctggagcatgggcctgtccctggtggagctg
gccatcggaaggtaccccatccccccgcccgacgccaaggagctggaggccatctttggc
cggccggtggtcgacggggaagaaggagagcctcacagcatctcgcctcggccgagaccc
cccgggcgccccatcagcggtcacgggatggatagccggcccgccatggccatcttcgaa
ctgctggactatattgtgaatgagccgcctcctaagctgcccaacggtgtgttcaccccc
gacttccaggagtttgtcaataaatgcctcatcaagaacccagcggagcgggcggacctg
aagatgctcacgaaccacaccttcatcaagcggtccgaggtggaagaagtggattttgcc
gggtggttgtgtaaaaccctgcgactgaaccagcccggcacacccacgcgcaccgccgtg
tga

DBGET integrated database retrieval system