KEGG   Macaca mulatta (rhesus monkey): 710441
Entry
710441            CDS       T01028                                 

Gene name
SPHK1
Definition
(RefSeq) sphingosine kinase 1 isoform X1
  KO
K04718  sphingosine kinase [EC:2.7.1.91]
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc00600  Sphingolipid metabolism
mcc01100  Metabolic pathways
mcc04020  Calcium signaling pathway
mcc04071  Sphingolipid signaling pathway
mcc04072  Phospholipase D signaling pathway
mcc04370  VEGF signaling pathway
mcc04371  Apelin signaling pathway
mcc04666  Fc gamma R-mediated phagocytosis
mcc05152  Tuberculosis
Module
mcc_M00100  Sphingosine degradation
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09100 Metabolism
  09103 Lipid metabolism
   00600 Sphingolipid metabolism
    710441 (SPHK1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04370 VEGF signaling pathway
    710441 (SPHK1)
   04371 Apelin signaling pathway
    710441 (SPHK1)
   04020 Calcium signaling pathway
    710441 (SPHK1)
   04072 Phospholipase D signaling pathway
    710441 (SPHK1)
   04071 Sphingolipid signaling pathway
    710441 (SPHK1)
 09150 Organismal Systems
  09151 Immune system
   04666 Fc gamma R-mediated phagocytosis
    710441 (SPHK1)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    710441 (SPHK1)
Enzymes [BR:mcc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.91  sphingosine kinase
     710441 (SPHK1)
SSDB
Motif
Pfam: DAGK_cat
Other DBs
NCBI-GeneID: 710441
NCBI-ProteinID: XP_014975919
Ensembl: ENSMMUG00000018011
LinkDB
Position
16
AA seq 499 aa
MSREPRAPPHGLRAMRERATPRAWSRDLVGPSPPLGAAAPDSASAVFSTSDPAAAGNDAG
APTATAPDGEGEPHSRPCDARLGSTDKELKAGAAATGSAPTAPGTPRQREPRVEVMDPAG
GPRGVLPRSCRVLVLLNPRGGKGKALQLFRSHVQPLLAEAEISFTLMLTERRNHARELVR
SEELGRWDALVVMSGDGLMHEVVNGLMERPDWETAIQKPLCSLPAGSGNALAASLNHYAG
YEQVTNEDLLTNCTRLLCRRLLSPMNLLSLHTASGLRLFSVLSLAWGFIADVDLESEKYR
RLGEMRFTLGTFLRLAALRTYRGRLAYLPVGRAGSKTPVSPVVVQQGPVDAHLVPLEEPV
PSHWTVVPDQDFVLVLALLHSHLGSEMFAAPMGRCAAGVMHLFYVRAGVSRAMLLRLFLA
MEKGRHMEYECPYLVYMPVVAFRLEPEDGRGVFTVDGELMVSEAVQGQVHPNYFWMVSEC
VEPLPSWKPQQTPPPEEPL
NT seq 1500 nt   +upstreamnt  +downstreamnt
atgtcccgggaacctagggccccgccccacgggcttcgggcgatgcgggagcgcgcaact
ccccgcgcgtggtcccgggatttagtcgggccctccccgcctttgggagctgcggctccg
gactccgccagcgctgtcttctctacctcagatccagccgccgcagggaatgacgccggt
gctcctacagccacggctccggacggggagggcgagccccacagccggccctgcgacgcc
cgcctgggcagcaccgataaggagctgaaggcaggagccgccgccacgggcagtgccccg
acagcgccagggaccccccggcagagggagccacgggtcgaggttatggatccagcgggc
ggcccccggggcgtgctcccgcggtcctgccgcgtgctggtgctgctgaacccgcgtggc
ggcaagggcaaggccctgcagctcttccggagtcacgtgcagccccttttggctgaggct
gaaatctccttcacgctgatgctcactgagcggcggaaccatgcgcgggagctggtgcgg
tcggaggagctgggccgctgggacgctctggtggtcatgtctggagacggactgatgcac
gaggtggtgaacgggctcatggagcggcctgactgggagaccgccatccagaagcccctg
tgtagcctcccagcaggctctggcaacgcgctggcagcttccttgaaccattatgctggc
tatgagcaggtcaccaatgaagacctcctgaccaactgcacgcggttgctgtgccgccgg
ctactgtcacccatgaacttgctgtctctgcacacggcttcggggctgcgcctcttctct
gtgctaagcctggcctggggcttcattgctgatgtggacctagagagtgagaagtatcgg
cgcctgggggagatgcgcttcactctgggcaccttcctgcgtctggcagccctgcgcact
taccgtggccgactggcctacctccctgtaggaagagccggctctaagacacctgtttct
cccgttgtggtccagcagggccccgtagatgcacaccttgtgccattggaggagccagtg
ccctctcactggacagtggtgcccgaccaggatttcgtgctggtgctagcgctgctgcac
tcgcacctgggcagcgagatgtttgcggcacccatgggccgctgtgcagctggtgtcatg
catctgttctatgtgcgggcgggagtgtctcgggccatgctgctgcgcctcttcctggcc
atggagaagggcaggcatatggaatatgaatgcccttacttggtatacatgcctgtggtc
gccttccgcttagagcccgaggatgggagaggtgtgtttacagtggatggggaattgatg
gttagcgaggctgtgcagggccaggtgcacccaaactacttctggatggtcagtgagtgc
gtggagcccctgcccagctggaagccccagcagacgccacctccagaagagcccttatga

KEGG   Macaca mulatta (rhesus monkey): 718088
Entry
718088            CDS       T01028                                 

Gene name
SPHK2
Definition
(RefSeq) sphingosine kinase 2
  KO
K04718  sphingosine kinase [EC:2.7.1.91]
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc00600  Sphingolipid metabolism
mcc01100  Metabolic pathways
mcc04020  Calcium signaling pathway
mcc04071  Sphingolipid signaling pathway
mcc04072  Phospholipase D signaling pathway
mcc04370  VEGF signaling pathway
mcc04371  Apelin signaling pathway
mcc04666  Fc gamma R-mediated phagocytosis
mcc05152  Tuberculosis
Module
mcc_M00100  Sphingosine degradation
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09100 Metabolism
  09103 Lipid metabolism
   00600 Sphingolipid metabolism
    718088 (SPHK2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04370 VEGF signaling pathway
    718088 (SPHK2)
   04371 Apelin signaling pathway
    718088 (SPHK2)
   04020 Calcium signaling pathway
    718088 (SPHK2)
   04072 Phospholipase D signaling pathway
    718088 (SPHK2)
   04071 Sphingolipid signaling pathway
    718088 (SPHK2)
 09150 Organismal Systems
  09151 Immune system
   04666 Fc gamma R-mediated phagocytosis
    718088 (SPHK2)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    718088 (SPHK2)
Enzymes [BR:mcc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.91  sphingosine kinase
     718088 (SPHK2)
SSDB
Motif
Pfam: DAGK_cat
Other DBs
NCBI-GeneID: 718088
NCBI-ProteinID: NP_001244416
Ensembl: ENSMMUG00000022159
UniProt: F6ZFF5 G7NNQ6
LinkDB
Position
19
AA seq 653 aa
MNGLLEAEEQDQRPEQELTRSWGHRPRSTLVRAKTMAPPPPPLAASTPLLHGEFGSYPAR
GPRFALTLTSQALHIQRLRPKPEARPRGGLVPLAEVSGCCTLRSRSPSDSAAYFCIYTYP
RSRRGSRRRTTRTFRTDGATTYEENRAEAQRWATALTCLLRGLPLPGDGEITPDLLPRPP
RLLLLVNPFGGRGLAWQWCKNYVLPMISEAGLSFNLIQTERQNHARELVQGLSLSEWDGI
VTVSGDGLLHEVLNGLLDRPDWEEAVKMPVGILPCGSGNALAGAVNQHGGFEPALGLDLL
LNCSLLLCRGGGHPLDLLSVTLASGSRCFSFLSVAWGFVSDVDIQSERFRALGSARFTLG
TVLGLATLHTYRGRLSYLPATVEPTSPTPVHSLPRAKSELTLTPDPAPPMAHSPLHRSVS
DLPLPLPQPALASPGSPEPLPILSLNGGGPELAGDWGGAGDAPLSPDPLLSSPPGSPKTA
LHSPVTEGAPVIPPSSGLPPPTADARVAASTCGLPDHLLPPLGTPLPPDWVTLEGDFVLM
LAISPSHLGADLVAAPHARFDDGLVHLCWVRSGISRAALLRLFLAMERGSQFSLGCPQLG
YAAARAFRLEPLTPRGVLTVDGEQVEYGPLQAQMHPGLGTLLTGPPGCPGREP
NT seq 1962 nt   +upstreamnt  +downstreamnt
atgaatggactccttgaagcagaggagcaggaccagaggccggaacaggagctgaccagg
agctggggccacaggcctaggagcaccctggtcagggctaagaccatggccccgccccca
ccgccactggctgccagcaccccgctcctccatggcgagtttggctcctacccagcccga
ggcccacgctttgccctcaccctcacgtcgcaggccctgcacatacagcggctgcgcccc
aaacccgaagccaggccccggggtggcctggtcccgttggccgaggtctcaggctgctgc
accctgcgaagccgtagcccctcagactcagcagcctacttctgcatctacacctaccct
cggagccggcgcgggagccggcgcagaaccacccgcaccttccggacagatggggctacc
acctacgaagagaaccgtgccgaggcccagcgctgggccaccgccctcacctgtctgctc
cgaggactgccgctgcccggggatggggagatcacccctgacctgctacctcggccgccc
aggttgctcctattggtcaatccctttggggggcggggcttggcctggcagtggtgtaag
aactacgtgcttcccatgatttctgaagctgggctgtccttcaacctcatccagacagaa
cgacagaaccacgctcgggagctggtccaggggctgagcctgagtgagtgggatggcatc
gtcacggtctcgggagacgggctgctccatgaggtgctgaacgggctcctagatcgccct
gactgggaggaagctgtgaagatgcctgtgggcatcctcccctgtggctcgggcaatgcg
ctggccggagcagtgaaccagcacgggggatttgagccagccctgggcctcgacctgctg
ctcaactgctcactgttgctctgccggggtggcggccacccactggacctgctctccgtg
acgctggcctcgggctcccgctgtttctccttcctgtctgtggcctggggcttcgtgtca
gatgtggatatccagagcgagcgcttcagggccttgggcagtgcccgcttcacactgggc
acggtgctgggcctcgccacactgcacacctaccgcggacgcctctcctacctccccgcc
actgtggaacccacctcgcccacccctgtccatagcctgccccgtgctaagtcagagctg
accctaaccccagacccagccccgcccatggcccactcacccctgcatcgttctgtgtct
gacctgcccctgcccctgccccaacctgccctggcctcccctggctcaccagaacccctg
cccatcctgtccctcaacggtgggggcccagagctggctggggactggggtggggctggg
gatgctccactgtccccggacccactgctgtcttcacctcctggctctcccaagacagct
ctacactcacccgtcactgagggggcccccgtaattcccccatcttctgggctcccaccg
cccaccgctgatgcccgggtagcggcctccacctgcggcctgcctgaccacctgctgcct
ccgctgggcaccccactgcccccagactgggtgacgctggagggggactttgtgctcatg
ttggccatatcgcccagccacctaggcgctgacctggtggcagctccgcacgcgcgcttc
gacgacggcctggtgcacctgtgctgggtgcgtagcggcatctcgcgggctgcgttgcta
cgccttttcctggccatggagcgtggtagccagttcagcctgggctgtccgcagctgggc
tacgccgcggcccgtgccttccgcctagagccgctcacgccgcgcggcgtgctcacggtg
gacggggagcaggtggagtatgggccgctacaggcacagatgcaccctggcctcggtaca
ctgctcaccgggcctcctggctgcccagggcgggagccctga

DBGET integrated database retrieval system