KEGG   Macaca mulatta (rhesus monkey): 710591
Entry
710591            CDS       T01028                                 

Gene name
NKX3-1
Definition
(RefSeq) homeobox protein Nkx-3.1
  KO
K09348  homeobox protein Nkx-3.1
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc05200  Pathways in cancer
mcc05215  Prostate cancer
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    710591 (NKX3-1)
  09162 Cancer: specific types
   05215 Prostate cancer
    710591 (NKX3-1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mcc03000]
    710591 (NKX3-1)
Transcription factors [BR:mcc03000]
 Eukaryotic type
  Helix-turn-helix
   Homeo domain only, NK-2
    710591 (NKX3-1)
SSDB
Motif
Pfam: Homeodomain Trypan_PARP Homeobox_KN Homez
Other DBs
NCBI-GeneID: 710591
NCBI-ProteinID: NP_001253152
Ensembl: ENSMMUG00000009796
UniProt: I2CX32
LinkDB
Position
8
AA seq 232 aa
MLRATEPLPGEAKAEGAAPPTPSKPLTSFLIQDILRDGAQRRGGHTDSPRRRDPEPEPEP
EGGRGPAGVQNDQLSPRPRAAPEEAETLAETEPERHLGSYLLDCENTSGSLPSLPQTPKQ
PQKRSRAAFSHTQVIELERKFSHQKYLSAPERAHLAKNLKLTETQVKIWFQNRRYKTKRK
QLSSELGDLEKHSSLPALKEEAFSRASLVSLYNNYPYYPYLYCVGSWSPAFW
NT seq 699 nt   +upstreamnt  +downstreamnt
atgctcagggctacggagccgctgcccggggaggcgaaagcggagggggccgcgccgcca
accccgtccaagccgctcacgtccttcctcatccaggacatcctgcgggacggcgcgcag
cggcgaggcggccacacggacagcccgagacggcgcgacccggagccagagccagagccg
gagggaggacgcggccccgccggggtacagaacgaccagctgagccccaggccccgcgcc
gcgccggaggaggccgagacgctggcggagacggagccagaaaggcacttggggtcttat
ctgttggactgtgaaaacacttcaggctcccttccaagcctcccccaaacccctaagcag
ccgcagaagcgctctcgagctgctttctcccacactcaggtgatcgagttggagaggaag
ttcagccatcagaagtacctgtcggcccctgaacgggcccacctggccaagaacctcaag
ctcacggagacccaagtgaagatatggttccagaacagacgctataagactaagagaaag
cagctctcctcggagctgggagacttggagaagcactcctctttgccggctctgaaagag
gaggccttctcccgggcctccctggtctccttgtataacaactatccttactacccatac
ctgtactgcgtgggcagctggagcccagctttttggtaa

DBGET integrated database retrieval system