KEGG   Macaca mulatta (rhesus monkey): 710605Help
Entry
710605            CDS       T01028                                 

Gene name
HDAC4
Definition
(RefSeq) histone deacetylase 4-like
  KO
K11406  histone deacetylase 4/5 [EC:3.5.1.98]
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04371  Apelin signaling pathway
mcc05034  Alcoholism
mcc05165  Human papillomavirus infection
mcc05169  Epstein-Barr virus infection
mcc05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:mcc00001]
 Environmental Information Processing
  Signal transduction
   04371 Apelin signaling pathway
    710605 (HDAC4)
 Human Diseases
  Cancers
   05203 Viral carcinogenesis
    710605 (HDAC4)
  Substance dependence
   05034 Alcoholism
    710605 (HDAC4)
  Infectious diseases
   05169 Epstein-Barr virus infection
    710605 (HDAC4)
   05165 Human papillomavirus infection
    710605 (HDAC4)
Enzymes [BR:mcc01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     710605 (HDAC4)
Chromosome and associated proteins [BR:mcc03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class II HDACs
     710605 (HDAC4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hist_deacetyl HDAC4_Gln
Motif
Other DBs
NCBI-GeneID: 710605
NCBI-ProteinID: XP_014966969
UniProt: H9ZFU5
LinkDB All DBs
Position
12
AA seq 1079 aa AA seqDB search
MSSQSHPDGLSGRDQPVELLNPARVNHMPSTVDVATALPLQVAPSAVPMDLRLDHQFSLP
VAEPALREQQLQQELLALKQKQQIQRQILIAEFQRQHEQLSRQHEAQLHEHIKQQQEMLA
MKHQQELLEHQRKLERHRQEQELEKQHREQKLQQLKNKEKGKESAVASTEVKMKLQEFVL
NKKKALAHRNLNHCISSDPRYWYGKTQHSSLDQSSPPQSGVSTSYNHPVLGMYDAKDDFP
LRKTASEPNLKLRSRLKQKVAERRSSPLLRRKDGPVVTALKKRPLDVTDSACSSAPGSGP
SSPNNSSGSVSAENGITPAVPSIPAETSLAHRLVAREGSAAPLPLYTSPSLPNITLGLPA
TGPAAGTAGQQDAERLTLPALQQRLSLFPGTHLTPYLSTSPLERDGGAAHSPLLQHMVLL
EQPPAQAPLVTGLGALPLHAQSLVGADRVSPSIHKLRQHRPLGRTQSAPLPQNAQALQHL
VIQQQHQQFLEKHKQQFQQQQLHMNKIIPKPSEPARQPESHPEETEEELREHQALLDEPY
LDRLPAQKEAHAPAGVQVKQEPIESDDEEAEPPREVEPGQRQPSEQELLFRQQALLLEQQ
RIHQLRNYQASMEAAGIPVSFGSHRPLSRAQSSPASATFPVSVQEPPTKPRFTTGLVYDT
LMLKHQCTCGSSSSHPEHAGRIQSIWSRLQETGLRGKCECIRGRKATLEELQTVHSEAHT
LLYGTNPLNRQKLDSSLASVFVRLPCGGVGVDSDTIWNEVHSAGAARLAVGCVVELVFKV
ATGELKNGFAVVRPPGHHAEESTPMGFCYFNSVAVAAKLLQQRLSVSKILIVDWDVHHGN
GTQQAFYSDPSVLYMSLHRYDDGNFFPGSGAPDEVGTGPGVGFNVNMAFTGGLDPPMGDA
EYLAAFRTVVMPIASEFAPDVVLVSSGFDAVEGHPTPLGGYNLSARCFGYLTKQLMGLAG
GRIVLALEGGHDLTAICDASEACVSALLGNELDPLPEKVLQQRPNANAVRSMEKVMEIHS
KYWRCLQRATSTAGRSLIEAQTCENEEAETVTAMASLSVGVKPAEKRADEEPMEEEPPL
NT seq 3240 nt NT seq  +upstreamnt  +downstreamnt
atgagctcccaaagccatccagatggactttctggccgagaccagccagtggagctgctg
aatcctgcccgcgtgaaccacatgcccagcacggtggatgtggccacggcactgcctcta
caagtggccccctcggcagtgcccatggacctgcgcctggaccaccagttctcgctgcct
gtggcagagcccgccctgcgggagcagcagctacagcaggagctcctggcgctcaagcag
aagcagcagatccagaggcagatcctcatcgccgagttccagaggcagcacgagcagctc
tcccggcagcacgaggcgcagctccacgagcacatcaagcaacagcaggagatgctggcc
atgaagcaccagcaggagctgctggaacaccagcggaagctggagaggcaccgccaggag
caggagctggagaagcagcaccgggagcagaagctgcagcagctcaagaacaaggagaag
ggcaaagagagtgccgtggccagcacagaagtgaagatgaagttacaagaatttgtcctc
aataaaaagaaggcactggcccatcggaatctgaaccactgcatttccagcgacccccgc
tactggtacgggaaaacgcagcacagttcccttgaccagagttctccaccccagagcgga
gtgtcaacctcctataaccacccagtcctgggaatgtacgacgccaaagatgacttccct
cttaggaaaacagcttctgaaccgaatctgaaattacggtccaggctaaagcagaaagtg
gccgaaagacggagcagccctctgctacgcaggaaagacgggccagtggtcactgctcta
aaaaagcgtccgttggatgtcacagattccgcgtgcagcagcgccccaggctctggaccc
agctcacccaacaacagctccgggagcgtcagcgcagagaacggcatcacgcccgccgtc
cccagcatcccggcggagacgagtttggcgcacagacttgtggcgcgagaaggctcggcc
gctccacttcccctctacacgtcgccgtccctgcccaacatcacgctgggcctgcctgcc
accggccctgctgctggcaccgcgggccagcaggatgccgagagactcacccttcccgcc
ctccagcagcgactctcccttttccccggcacccacctcactccctacctgagcacctcg
cccttggagcgggacggaggggcagcgcacagccctcttctgcagcacatggtcttactg
gagcagccgccggcacaagcgcccctcgtcacaggcctgggagcactgcccctccacgca
cagtccttggttggtgcggaccgggtgtccccctccatccacaagctgcggcagcaccgc
ccgctggggcgaacccagtcggccccgctgccccagaacgcccaggctctgcagcacctg
gtcatccagcagcagcatcagcagtttctggagaaacacaagcagcagttccagcagcag
caactgcacatgaacaagatcatcccgaaaccaagcgagccggcccggcagccggagagt
cacccagaggagacggaggaggagctccgtgagcaccaggctctgctggacgagccctac
ctggaccggctgccagcgcagaaggaggcgcacgcaccagctggcgtgcaggtgaagcag
gagcccattgagagcgatgacgaagaggcagagccccctcgggaggtggagccgggtcag
cgccagcccagtgagcaggagctgctcttcagacagcaagccctcctgctggagcagcag
cggatccaccagctgaggaactaccaggcgtccatggaggctgccggcattcccgtgtcc
ttcggcagccacaggcctctgtcccgggcgcagtcctcaccggcatctgccacctttccc
gtgtctgtgcaggagccccccaccaagccgaggttcacgacaggcctcgtgtatgacacg
ctgatgctgaagcaccagtgcacctgcgggagcagcagcagccaccccgagcacgccggg
aggatccagagcatctggtcccgcctgcaggagacaggcctccggggcaaatgcgagtgc
atccgcggacgcaaggccaccctggaggagctgcagacggtgcactcggaagcccacacc
ctcctgtacggcacaaatcccctcaaccggcagaaactggacagctcgcttgcctccgtg
ttcgtccggctcccctgcggtggtgttggggtggacagcgacaccatatggaacgaggtg
cactcggcgggggcggcccgcctggccgtgggctgcgtggtggagctggtcttcaaggtg
gccacgggggagctgaagaatggctttgctgtggtccgcccccctggacaccacgcggag
gagagcacacccatgggcttttgctacttcaactccgtggccgtggcagccaagcttctg
cagcagaggttgagcgtgagcaagatcctcatcgtggactgggacgtgcaccatggaaac
gggacccagcaggctttctacagcgaccccagcgtcctgtacatgtccctccaccgctac
gacgatggcaacttcttcccgggcagcggggctcctgacgaggtgggcacagggcccggc
gtgggtttcaacgtcaacatggctttcactggcggcctggaccctcccatgggagatgct
gagtacttggcggccttcagaacggtggtcatgccgatcgctagcgagtttgccccggac
gtggtgttggtgtcatcgggcttcgacgctgtggagggccaccccacacctctcgggggc
tacaacctctccgccagatgctttgggtacctgacgaagcagctgatgggcctggctggc
ggccggatcgtcctggccctcgagggaggccacgacctgaccgccatttgcgacgcctcc
gaagcatgcgtttctgccttgctgggaaatgagcttgatcctctcccagaaaaggtttta
cagcaaagacccaatgcaaacgctgtccgctccatggagaaagtcatggaaatccacagc
aagtactggcgctgcctgcagcgtgcaacctccacggcagggcgttctctgatcgaggct
cagacctgcgagaacgaagaagccgagacggtcaccgccatggcctcgctgtccgtgggc
gtgaagcccgccgaaaagagagcagacgaggagcccatggaagaggagccgcccctgtag

DBGET integrated database retrieval system