KEGG   Macaca mulatta (rhesus monkey): 710692
Entry
710692            CDS       T01028                                 

Gene name
FHL1
Definition
(RefSeq) four and a half LIM domains protein 1 isoform X1
  KO
K14365  four and a half LIM domains protein 1
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    710692 (FHL1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:mcc04990]
    710692 (FHL1)
Domain-containing proteins not elsewhere classified [BR:mcc04990]
 LIM domain-containing proteins
  FHL family proteins
   710692 (FHL1)
SSDB
Motif
Pfam: LIM Ureidogly_lyase
Other DBs
NCBI-GeneID: 710692
NCBI-ProteinID: XP_001102451
Ensembl: ENSMMUG00000007922
UniProt: A0A1D5QTS1
LinkDB
Position
X
AA seq 339 aa
MASHRHSGPSSYKVGTMAEKFDCHYCRDPLQGKKYVQKDGHHCCLKCFDKFCANTCVECR
KPIGADSKEVHYKNRFWHDTCFRCAKCLHPLANETFVAKDNKILCNKCTTREDSPKCKGC
FKAIVAGDQNVEYKGTVWHKDCFTCSNCKQVIGTGSFFPKGEDFYCVTCHETKFAKHCVK
CNKAITSGGITYQDQPWHADCFVCVTCSKKLAGQRFTAVEDQYYCVDCYKNFVAKKCAGC
KNPITGKRTVSRVSHPVSKARKPPVCHGKRLPLTLFPSANLRGRHPGGERTCPSWVVVLY
RKNRSLAAPRGPGLVKAPVWWPMKDNPGTTTASTAKNAP
NT seq 1020 nt   +upstreamnt  +downstreamnt
atggcttcccatagacactcaggtccctccagctataaggtgggcaccatggcggagaag
tttgactgccactactgcagggaccccttgcaggggaagaagtatgtgcaaaaggatggc
caccactgctgcctgaaatgctttgacaagttctgtgccaacacctgtgtggaatgccgc
aagcccatcggtgcggactccaaggaggtgcactataagaaccgcttctggcacgacacc
tgcttccgctgtgccaagtgccttcaccccttggccaatgagacctttgtggccaaggac
aacaagatcctgtgcaacaagtgcaccactcgggaggactcccccaagtgcaaggggtgc
ttcaaggccattgtggcaggagatcaaaacgtggagtacaaggggaccgtctggcacaaa
gactgcttcacctgtagtaactgcaagcaagtcatcgggactggaagcttcttccctaaa
ggggaggacttctactgcgtgacttgccatgagaccaagtttgccaagcattgcgtgaag
tgcaacaaggccatcacatctggaggaatcacttaccaggatcagccctggcatgccgat
tgctttgtgtgtgttacctgctctaagaagctggctgggcagcgtttcaccgctgtggag
gaccagtattactgcgtggattgctacaagaactttgtggccaagaagtgtgctggatgc
aagaaccccatcactgggaaaaggactgtgtcaagagtgagccacccagtctctaaagct
aggaagcccccagtgtgccacgggaaacgcttgcctctcaccctgtttcccagcgccaac
ctccggggcaggcatccgggtggagagaggacttgtccctcgtgggtggtggttctttat
agaaaaaatcgaagcttagcagctcctcgaggcccgggtttggtaaaggctccagtgtgg
tggcctatgaaggacaatcctggcacgactactgcttccactgcaaaaaatgctccgtga

DBGET integrated database retrieval system