KEGG   Macaca mulatta (rhesus monkey): 710797Help
Entry
710797            CDS       T01028                                 

Definition
(RefSeq) histone deacetylase 4
  KO
K11406  histone deacetylase 4/5 [EC:3.5.1.98]
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04371  Apelin signaling pathway
mcc05034  Alcoholism
mcc05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    710797
 09160 Human Diseases
  09161 Cancers: Overview
   05203 Viral carcinogenesis
    710797
  09165 Substance dependence
   05034 Alcoholism
    710797
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mcc03036]
    710797
Enzymes [BR:mcc01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     710797
Chromosome and associated proteins [BR:mcc03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class II HDACs
     710797
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hist_deacetyl HDAC4_Gln
Motif
Other DBs
NCBI-GeneID: 710797
NCBI-ProteinID: XP_014966971
UniProt: F6VW34
LinkDB All DBs
Position
12
AA seq 1089 aa AA seqDB search
MSSQSHPDGLSGRDQPVELLNPARVNHMPSTVDVATALPLQVAPSAVPMDLRLDHQFSLP
VAEPALREQQLQQELLALKQKQQIQRQILIAEFQRQHEQLSRQHEAQLHEHIKQQQEMLA
MKHQQELLEHQRKLERHRQEQELEKQHREQKLQQLKNKEKGKESAVASTEVKMKLQEFVL
NKKKALAHRNLNHCISSDPRYWYGKTQHSSLDQSSPPQSGVSTSYNHPVLGMYDAKDDFP
LRKTASEPNLKLRSRLKQKVAERRSSPLLRRKDGPVVTALKKRPLDVTDSACSSAPGSGP
SSPNNSSGSVSAENGITPAVPSIPAETSLAHRLVAREGSAAPLPLYTSPSLPNITLGLPA
TGPAAGTAGQQDAERLTLPALQQRLSLFPGTHLTPYLSTSPLERDGGAAHSPLLQHMVLL
EQPPAQAPLVTDWYLSGLGALPLHAQSLVGADRVSPSIHKLRQHRPLGRTQSAPLPQNAQ
ALQHLVIQQQHQQFLEKHKQQFQQQQLHMNKIIPKPSEPARQPESHPEETEEELREHQAL
LDEPYLDRLPAQKEAHAPAGVQVKQEPIESDDEEAEPPREVEPGQRQPSEQELLFRQQAL
LLEQQRIHQLRNYQASMEAAGIPVSFGSHRPLSRAQSSPASATFPVSVQEPPTKPRFTTG
LVYDTLMLKHQCTCGSSSSHPEHAGRIQSIWSRLQETGLRGKCECIRGRKATLEELQTVH
SEAHTLLYGTNPLNRQKLDSKKLLGSLASVFVRLPCGGVGVDSDTIWNEVHSAGAARLAV
GCVVELVFKVATGELKNGFAVVRPPGHHAEESTPMGFCYFNSVAVAAKLLQQRLSVSKIL
IVDWDVHHGNGTQQAFYSDPSVLYMSLHRYDDGNFFPGSGAPDEVGTGPGVGFNVNMAFT
GGLDPPMGDAEYLAAFRTVVMPIASEFAPDVVLVSSGFDAVEGHPTPLGGYNLSARCFGY
LTKQLMGLAGGRIVLALEGGHDLTAICDASEACVSALLGNELDPLPEKVLQQRPNANAVR
SMEKVMEIHSKYWRCLQRATSTAGRSLIEAQTCENEEAETVTAMASLSVGVKPAEKRADE
EPMEEEPPL
NT seq 3270 nt NT seq  +upstreamnt  +downstreamnt
atgagctcccaaagccatccagatggactttctggccgagaccagccagtggagctgctg
aatcctgcccgcgtgaaccacatgcccagcacggtggatgtggccacggcactgcctcta
caagtggccccctcggcagtgcccatggacctgcgcctggaccaccagttctcgctgcct
gtggcagagcccgccctgcgggagcagcagctacagcaggagctcctggcgctcaagcag
aagcagcagatccagaggcagatcctcatcgccgagttccagaggcagcacgagcagctc
tcccggcagcacgaggcgcagctccacgagcacatcaagcaacagcaggagatgctggcc
atgaagcaccagcaggagctgctggaacaccagcggaagctggagaggcaccgccaggag
caggagctggagaagcagcaccgggagcagaagctgcagcagctcaagaacaaggagaag
ggcaaagagagtgccgtggccagcacagaagtgaagatgaagttacaagaatttgtcctc
aataaaaagaaggcactggcccatcggaatctgaaccactgcatttccagcgacccccgc
tactggtacgggaaaacgcagcacagttcccttgaccagagttctccaccccagagcgga
gtgtcgacctcctataaccacccagtcctgggaatgtacgacgccaaagatgacttccct
cttaggaaaacagcttctgaaccgaatctgaaattacggtccaggctaaagcagaaagtg
gccgaaagacggagcagccctctgctacgcaggaaagacgggccagtggtcactgctcta
aaaaagcgtccgttggatgtcacagattccgcgtgcagcagcgccccaggctctggaccc
agctcacccaacaacagctccgggagcgtcagcgcagagaacggcatcacgcccgccgtc
cccagcatcccggcggagacgagtttggcgcacagacttgtggcgcgagaaggctcggcc
gctccacttcccctctacacgtcgccgtccctgcccaacatcacgctgggcctgcctgcc
accggccctgctgctggcacggcgggccagcaggatgccgagagactcacccttcccgcc
ctccagcagcgactctcccttttccccggcacccacctcactccctacctgagcacctcg
cccttggagcgggacggaggggcagcgcacagccctcttctgcagcacatggtcttactg
gagcagccgccggcacaagcgcccctcgtcacagactggtatctttcaggcctgggagca
ctgcccctccacgcacagtccttggttggtgcggaccgggtgtccccctccatccacaag
ctgcggcagcaccgcccgctggggcgaacccagtcggccccgctgccccagaacgcccag
gctctgcagcacctggtcatccagcagcagcatcagcagtttctggagaaacacaagcag
cagttccagcagcagcaactgcacatgaacaagatcatcccgaaaccaagcgagccggcc
cggcagccggagagtcacccagaggagacggaggaggagctccgtgagcaccaggctctg
ctggacgagccctacctggaccggctgccggcgcagaaggaggcgcacgcaccagctggc
gtgcaggtgaagcaggagcccattgagagcgatgacgaagaggcagagccccctcgggag
gtggagccgggccagcgccagcccagtgagcaggagctgctcttcagacagcaagccctc
ctgctggagcagcagcggatccaccagctgaggaactaccaggcgtccatggaggctgcc
ggcattcccgtgtccttcggcagccacaggcctctgtcccgggcgcagtcctcaccggca
tctgccacctttcccgtgtctgtgcaggagccccccaccaagccgaggttcacgacaggc
ctcgtgtatgacacgctgatgctgaagcaccagtgcacctgcgggagcagcagcagccac
cccgagcacgccgggaggattcagagcatctggtcccgcctgcaggagacaggcctccgg
ggcaaatgcgagtgcatccgcggacgcaaggccaccctggaggagctgcagacggtgcac
tcggaagcccacaccctcctgtacggcacaaatcccctcaaccggcagaaactggacagt
aagaaacttctaggctcgctcgcctccgtgttcgtccggctcccctgcggtggtgttggg
gtggacagcgacaccatatggaacgaggtgcactcggcgggggcagcccgcctggccgtg
ggctgcgtggtggagctggtcttcaaggtggccacgggggagctgaagaatggctttgct
gtggtccgcccccctggacaccacgcggaggagagcacacccatgggcttttgctacttc
aactccgtggccgtggcagccaagcttctgcagcagaggttgagcgtgagcaagatcctc
atcgtggactgggacgtgcaccatggaaacgggacccagcaggctttctacagcgacccc
agcgtcctgtacatgtccctccaccgctacgacgatggcaacttcttcccgggcagcggg
gctcctgacgaggtgggcacagggcccggcgtgggtttcaacgtcaacatggctttcact
ggcggcctggaccctcccatgggagatgctgagtacttggcggccttcagaacggtggtc
atgccgatcgctagcgagtttgccccggacgtggtgttggtgtcatcgggcttcgacgct
gtggagggccaccccacacctctcgggggctacaacctctccgccagatgctttgggtac
ctgacgaagcagctgatgggcctggctggcggccggatcgtcctggccctcgagggaggc
cacgacctgaccgccatttgcgacgcctccgaagcatgcgtttctgccttgctgggaaat
gagcttgatcctctcccagaaaaggttttacagcaaagacccaatgcaaacgctgtccgc
tccatggagaaagtcatggaaatccacagcaagtactggcgctgcctgcagcgtgcaacc
tccacggcagggcgttctctgatcgaggctcagacctgcgagaacgaagaagccgagacg
gtcaccgccatggcctcgctgtccgtgggcgtgaagcccgccgaaaagagagcagacgag
gagcccatggaagaggagccgcccctgtag

DBGET integrated database retrieval system