KEGG   Macaca mulatta (rhesus monkey): 710979
Entry
710979            CDS       T01028                                 

Gene name
MAP3K1
Definition
(RefSeq) mitogen-activated protein kinase kinase kinase 1
  KO
K04416  mitogen-activated protein kinase kinase kinase 1 [EC:2.7.11.25]
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04010  MAPK signaling pathway
mcc04120  Ubiquitin mediated proteolysis
mcc04530  Tight junction
mcc04622  RIG-I-like receptor signaling pathway
mcc04722  Neurotrophin signaling pathway
mcc04912  GnRH signaling pathway
mcc04935  Growth hormone synthesis, secretion and action
mcc05161  Hepatitis B
mcc05166  Human T-cell leukemia virus 1 infection
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    710979 (MAP3K1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    710979 (MAP3K1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    710979 (MAP3K1)
 09150 Organismal Systems
  09151 Immune system
   04622 RIG-I-like receptor signaling pathway
    710979 (MAP3K1)
  09152 Endocrine system
   04912 GnRH signaling pathway
    710979 (MAP3K1)
   04935 Growth hormone synthesis, secretion and action
    710979 (MAP3K1)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    710979 (MAP3K1)
 09160 Human Diseases
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    710979 (MAP3K1)
   05161 Hepatitis B
    710979 (MAP3K1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mcc01001]
    710979 (MAP3K1)
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:mcc04121]
    710979 (MAP3K1)
Enzymes [BR:mcc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.25  mitogen-activated protein kinase kinase kinase
     710979 (MAP3K1)
Protein kinases [BR:mcc01001]
 Serine/threonine kinases: STE group
  STE11 family
   710979 (MAP3K1)
Ubiquitin system [BR:mcc04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   Other single Ring-finger type E3
    710979 (MAP3K1)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kinase-like Pkinase_fungal zf-RING_2 PHD Phostensin_N APH FANCL_C zf-ANAPC11
Other DBs
NCBI-GeneID: 710979
NCBI-ProteinID: XP_002804414
Ensembl: ENSMMUG00000012387
UniProt: A0A5F8ATC1
LinkDB
Position
6
AA seq 1508 aa
MAAAAGNRASSSGFPGAGAASPEAGGGGGALKASSVPAAAAGLLREAGSGGRERADWRRR
QLRKVRSVELDQLPEPPLFLAASPPSSSTSPSPEPADAAGSGTGFQPVAVPPPHGAASRG
GAHPAEPVAAPDSGASSPAAAEPGEKRAPAAEPPPAAAPAGREMENKETLKGLHKMDDRP
EERMIREKLKATCMPAWKHEWLERRNRRGPVVVKPIPVKGDGSEMNHLAAESPGEAQASM
ASPASKGRRSPSPGNSPSGRTVKSESPGVRRKRVSPVPFQSGRITPPRRAPSPDGFSPYS
PEETNRRVNKVMRARLYLLQQIGPNSFLIGGDSPDNKYRVFIGPQNCSCGRGTFCIHLLF
VMLRVFQLEPSDPMLWRKTLKNFEVESLFQKYHSRRSSRIKAPSRNTIQKFVSRMSNSHT
LSSSSTSTSSSENSIKDEEEQMCPICLLGMLDEESLTVCEDGCRNKLHHHCMSIWAEECR
RNREPLICPLCRSKWRSHDFYSHELSSPVDSPSSLRAAQQQTVQQQPLAGSQRRNQESNF
NLTHYGTQQIPPAYKDLAEPWIQVFGMELVGCLFSRNWNVREMALRRLSHDVSGALLLAN
GESTGNSGGSSGSSPSGGAASGSSQTSISGDVVEACCNVLSMVCADPVYKVYVAALKTLR
AMLVYTPCHSLAERIKLQRLLRPVVDTILVKCADANSRTSQLSISTLLELCKGQAGELAV
GREILKAGSIGIGGVDYVLNCILGNQTESNNWQELLGRLCLIDRLLLEFPAEFYPHIVST
DVSQAEPVEIRYKKLLSLLTFALQSIDNSHSMVGKLSRRIYLSSARMVTTVPHVFSKLLE
MLSVSSSTHFTRMRRRLMAIADEVEIAEAIQLGVEDTLDGQQDSFLQASVPSDYPETTEK
SSPECTIHLEKTGKGLCATKLSASSEDISERLASISVGPSSSTTTEQPKPMVQTKGRPHS
QCLNSSPLSPHSQLMFPALSSPSSSAPSVPAGTATDVSKHRLQGFVPCKIPSASPQTQRK
FSLQFHRNCPENRDSDKLSPVFTQSRPLPSSNIHRPKPSRPTPGNTSKQGDPSKNSMTLD
LNSSSKCDDNFGCSSSSSNAVIPSDETVFTPVEEKCRLDVNTELNSSIEDLLEASMPSSD
TTVTFKSEVAVLSPEKAENDDTYKDDVNHNQKCKEKMEAEEEEALAIAMAMSASQDALPI
VPQLQVENGEDIIIIQQDTPETLPGHTKAKQPYREDTEWLKGQQIGLGAFSSCYQAQDVG
TGTLMAVKQVTYVRNTSSEQEEVVEALREEIRMMSHLNHPNIIRMLGATCEKSNYNLFIE
WMAGGSVAHLLSKYGAFKESVVINYTEQLLRGLSYLHENQIIHRDVKGANLLIDSTGQRL
RIADFGAAARLASKGTGAGEFQGQLLGTIAFMAPEVLRGQQYGRSCDVWSVGCAIIEMAC
AKPPWNAEKHSNHLALIFKIASATTAPSIPSHLSPGLRDVALRCLELQPQDRPPSRELLK
HPVFRTTW
NT seq 4527 nt   +upstreamnt  +downstreamnt
atggcggcggcggcggggaatcgcgcctcgtcgtctggattcccgggcgccggggctgca
agccctgaggcgggcggcggcggaggggccctcaaggcgagcagcgtgcccgcggcggcc
gcgggactgctgcgggaggcgggcagcgggggccgcgagcgggcggactggcggcggcgg
cagctgcgcaaagtgcggagtgtggagctggaccagctgcctgagccgccgctcttcctt
gccgcctcaccgccgtcctcctcgacttccccgtcgccggagcccgcggacgcagcgggg
agtgggaccggcttccagcctgtggcggtgccgccgccccacggagccgcgagccgcggc
ggcgcccaccctgccgagccggtggccgcgccggacagcggcgcctcgagtcccgcagcg
gccgagcccggggagaagcgggcgcccgccgccgagccacctcctgcagcggcccccgcc
ggtcgtgagatggagaataaagaaactctcaaagggttgcacaagatggacgatcgtcca
gaggaacgaatgatcagggagaaactgaaggcaacctgtatgccagcgtggaagcacgaa
tggttggaaaggagaaataggcgagggcctgtggtggtaaaaccaatcccagttaaagga
gatggatctgaaatgaatcacttggcagctgagtctccaggagaggcccaggcgagtatg
gcttcaccagcttccaaaggccgacgcagtccttctcctggcaactccccatcaggtcgc
acagtgaaatcagaatctccaggagtaaggagaaaaagagtttccccagtgccttttcag
agtggcagaatcacaccaccccgaagagccccttcaccagatggcttctcaccatatagc
cctgaggaaacaaatcgccgtgttaacaaagtgatgcgggccagactgtacttattgcag
cagatagggcccaactctttcctgattggaggagacagcccagacaataaataccgggtg
tttattgggcctcagaactgcagctgtggacgtggaacattctgtattcatctgctgttt
gtaatgctccgggtgtttcaactagaaccttcagacccaatgttatggagaaaaacttta
aagaattttgaggttgagagtttgttccagaaatatcacagtaggcgtagctcaaggatc
aaagctccatctcgtaacaccatccagaagtttgtttcacgcatgtcaaattctcataca
ttgtcatcatctagtacttctacatctagttcagaaaacagtataaaggatgaagaggag
cagatgtgtcctatttgcttattgggcatgcttgatgaagaaagtcttacagtgtgtgaa
gacggctgcaggaacaagctgcaccaccactgcatgtcaatttgggcagaagagtgtaga
agaaatagagaacctttaatatgtcccctttgtagatctaagtggaggtctcatgatttc
tacagccacgaattgtcaagtcctgtggattccccttcttccctcagagctgcacagcag
cagaccgtacagcagcagcctttggctggatcacaaagaaggaatcaagagagcaatttt
aaccttactcattatggaactcagcaaatccctcctgcttacaaagatttagctgagcca
tggattcaggtatttggaatggaactcgttggctgcttattttctagaaactggaatgtg
agagagatggccctcaggcgtctttcccatgatgtcagtggggccctgctgttggcaaat
ggggagagcactggaaattccgggggcagcagtggaagcagcccgagtgggggagctgcc
agtgggtcttcccagacgagtatctcaggagatgtggtggaggcatgctgcaacgttctg
tcaatggtctgtgctgaccctgtctacaaagtgtacgttgctgctttaaaaacattgaga
gccatgctggtatatactccttgtcacagtttagcggaaagaatcaaacttcagagactt
ctccggccagttgtagacaccatcctagtcaaatgtgcagatgccaatagccgcacaagt
cagctgtccatatcaacactgttggaactgtgcaaaggccaagcaggagagttggcagtt
ggcagagaaatacttaaagctggatccattggtattggtggtgttgattatgtcttaaat
tgtattcttggaaaccaaactgaatcaaacaattggcaagaacttcttggccgcctttgt
cttatagatagactgttgttggaatttcctgctgaattttatcctcatattgtcagtact
gatgtttcacaagctgagcctgttgaaatcaggtataagaagctgctgtccctcttaacc
tttgctttgcagtccattgataattcccactcaatggttggcaaactttccagaaggatc
tacttgagttccgcaagaatggttactacagtgccccatgtgttttcaaaactgttagaa
atgctgagtgtttccagttccactcacttcaccaggatgcgtcgccgtttgatggctatt
gcagatgaggtggaaattgctgaagccatccagttgggcgtagaagacactttggatggt
caacaggacagctttttgcaggcatctgttcccagtgactatccggaaaccacagagaag
agttcccctgagtgcacaatccatttagagaaaactggaaaaggattatgtgctacaaaa
ttgagtgccagttcagaggacatttctgagagactggccagcatttcagtaggaccttct
agttcaacaacaacagagcaaccaaagccaatggttcaaacaaaaggcaggccccatagt
cagtgtttgaactcctctcctttatctcctcattcccaattaatgtttccagccttgtca
agcccttcttcttcggccccatctgtaccagctggcactgcaacagatgtctctaagcat
agacttcagggattcgttccctgcaaaataccttctgcatctcctcaaacacagcgcaag
ttttctctacaattccacagaaactgtcctgaaaacagagactcagataaactttcccca
gtctttactcagtcaagacccttgccctccagtaatatacacaggccaaagccatctcga
cctaccccaggtaatacaagtaaacagggagatccctcaaaaaatagcatgacacttgat
ctgaacagtagttccaaatgtgatgacaactttggctgtagcagcagtagtagtaatgcc
gttatacccagtgatgagacggtgttcaccccagtagaggagaaatgcagattagatgtc
aatacagagctcaactccagtattgaggaccttcttgaagcatctatgccttcaagtgat
acaacagtcactttcaagtcagaagttgctgtcctctctcctgaaaaggctgaaaatgat
gatacctacaaagatgatgtgaatcataatcaaaagtgcaaagaaaagatggaagctgaa
gaagaagaagctttagcaattgccatggcaatgtcagcgtctcaggatgccctccccata
gttcctcagctgcaggttgaaaatggagaagatatcatcattattcaacaggatacacca
gagactctaccgggacataccaaagcaaaacaaccgtatagagaagatactgaatggctg
aaaggtcaacagataggccttggagcattttcttcttgttatcaggctcaagatgtggga
actggaactttaatggctgttaaacaggtgacttatgtcagaaacacatcatctgagcaa
gaagaagtagtagaagcattaagagaagagataagaatgatgagccatctgaatcatcca
aacatcattaggatgttgggagccacgtgtgagaagagcaattacaatctcttcattgaa
tggatggcagggggatctgtggctcatttgctgagtaaatatggagctttcaaagaatca
gtagttattaactacactgaacaattacttcgtggcctttcgtatctccatgaaaaccaa
atcattcacagagatgtcaaaggtgccaatttgctaattgacagcactggtcagagacta
agaattgcagattttggagctgcagccaggttggcatcaaaaggaactggtgcaggagag
tttcagggacaattactggggacaattgcatttatggcacctgaggtactaagaggtcaa
cagtatggaaggagctgtgatgtatggagtgttggctgtgctattatagaaatggcttgt
gcaaaaccaccatggaatgcagaaaaacactccaatcatcttgctttgatatttaagatt
gctagtgcaacgactgctccatcgatcccttcacatttgtctcccggcttacgagatgtg
gctcttcgttgtttagaacttcaacctcaggacagacctccatcaagagagctactaaag
catccagtctttcgtactacgtggtag

DBGET integrated database retrieval system