KEGG   Macaca mulatta (rhesus monkey): 711095
Entry
711095            CDS       T01028                                 

Gene name
PIN1
Definition
(RefSeq) peptidyl-prolyl cis-trans isomerase NIMA-interacting 1
  KO
K09578  peptidyl-prolyl cis-trans isomerase NIMA-interacting 1 [EC:5.2.1.8]
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04622  RIG-I-like receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09150 Organismal Systems
  09151 Immune system
   04622 RIG-I-like receptor signaling pathway
    711095 (PIN1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:mcc03021]
    711095 (PIN1)
   03110 Chaperones and folding catalysts [BR:mcc03110]
    711095 (PIN1)
Enzymes [BR:mcc01000]
 5. Isomerases
  5.2  cis-trans-Isomerases
   5.2.1  cis-trans Isomerases (only sub-subclass identified to date)
    5.2.1.8  peptidylprolyl isomerase
     711095 (PIN1)
Transcription machinery [BR:mcc03021]
 Eukaryotic type
  RNA polymerase II system
   Other transcription-related factors
    Transcription termination factor
     711095 (PIN1)
Chaperones and folding catalysts [BR:mcc03110]
 Protein folding catalysts
  Peptidyl prolyl isomerase
   Parvulin
    711095 (PIN1)
SSDB
Motif
Pfam: Rotamase Rotamase_3 WW Rotamase_2 MBD
Other DBs
NCBI-GeneID: 711095
NCBI-ProteinID: XP_014978313
Ensembl: ENSMMUG00000008245
UniProt: I2CYP4
LinkDB
Position
19
AA seq 163 aa
MADEEKLPPGWEKRMSRSSGRVYYFNHITNASQWERPSGNSSSGGKNGQGEPARVRCSHL
LVKHSQSRRPSSWRQEKITRTKEEALELINGYIQKIKSGEEDFESLASQFSDCSSAKARG
DLGAFSRGQMQKPFEDASFALRTGEMSGPVFTDSGIHIILRTE
NT seq 492 nt   +upstreamnt  +downstreamnt
atggcggacgaggagaagctgccgcccggctgggagaagcgcatgagccgcagctcaggc
cgagtatactacttcaaccacatcactaacgccagccagtgggagcggcccagcggcaac
agcagcagtggtggcaaaaacgggcagggggagcccgccagggtccgctgctcacacctg
ctggtgaagcacagccagtcaaggcggccctcgtcctggcggcaggagaagatcacccgg
accaaggaggaggccctggagctgatcaacggctacatccagaagatcaagtcgggagag
gaggactttgagtctctggcctcacagttcagcgactgcagctcagccaaggccagggga
gacctgggtgccttcagcagaggtcagatgcagaagccatttgaagacgcctcgtttgcg
ctgcggacgggggagatgagcgggcctgtgttcacggattccggcatccacatcatcctc
cgcactgagtga

DBGET integrated database retrieval system