KEGG   Macaca mulatta (rhesus monkey): 711353
Entry
711353            CDS       T01028                                 

Gene name
PDGFRB
Definition
(RefSeq) platelet-derived growth factor receptor beta
  KO
K05089  platelet-derived growth factor receptor beta [EC:2.7.10.1]
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc01521  EGFR tyrosine kinase inhibitor resistance
mcc04010  MAPK signaling pathway
mcc04014  Ras signaling pathway
mcc04015  Rap1 signaling pathway
mcc04020  Calcium signaling pathway
mcc04072  Phospholipase D signaling pathway
mcc04151  PI3K-Akt signaling pathway
mcc04510  Focal adhesion
mcc04540  Gap junction
mcc04630  JAK-STAT signaling pathway
mcc04810  Regulation of actin cytoskeleton
mcc05165  Human papillomavirus infection
mcc05200  Pathways in cancer
mcc05206  MicroRNAs in cancer
mcc05214  Glioma
mcc05215  Prostate cancer
mcc05218  Melanoma
mcc05230  Central carbon metabolism in cancer
mcc05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    711353 (PDGFRB)
   04014 Ras signaling pathway
    711353 (PDGFRB)
   04015 Rap1 signaling pathway
    711353 (PDGFRB)
   04630 JAK-STAT signaling pathway
    711353 (PDGFRB)
   04020 Calcium signaling pathway
    711353 (PDGFRB)
   04072 Phospholipase D signaling pathway
    711353 (PDGFRB)
   04151 PI3K-Akt signaling pathway
    711353 (PDGFRB)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    711353 (PDGFRB)
   04540 Gap junction
    711353 (PDGFRB)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    711353 (PDGFRB)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    711353 (PDGFRB)
   05206 MicroRNAs in cancer
    711353 (PDGFRB)
   05230 Central carbon metabolism in cancer
    711353 (PDGFRB)
   05231 Choline metabolism in cancer
    711353 (PDGFRB)
  09162 Cancer: specific types
   05214 Glioma
    711353 (PDGFRB)
   05218 Melanoma
    711353 (PDGFRB)
   05215 Prostate cancer
    711353 (PDGFRB)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    711353 (PDGFRB)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    711353 (PDGFRB)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mcc01001]
    711353 (PDGFRB)
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:mcc04090]
    711353 (PDGFRB)
Enzymes [BR:mcc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     711353 (PDGFRB)
Protein kinases [BR:mcc01001]
 Receptor tyrosine kinases (RTK)
  PDGFR family [OT]
   711353 (PDGFRB)
CD molecules [BR:mcc04090]
 Proteins
  711353 (PDGFRB)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase ig Ig_3 I-set Ig_2 V-set C1-set Ig_6 TrmE_N
Other DBs
NCBI-GeneID: 711353
NCBI-ProteinID: XP_001107595
Ensembl: ENSMMUG00000011557
UniProt: F7BTH1
LinkDB
Position
6
AA seq 1106 aa
MRLPGAMPALALKGQLLLLPLLLLLEPQVSQGLVITPPGPELILNVSSTFVLTCSGSAPV
VWERMSQELPQEMAKAQDNTFSSVLTLTNLTGLDTGEYFCTYNDSRGLEPDERKRLYIFV
PDPTMGFLPNDAEELFIFLTEITEITIPCRVTDPQLVVTLHEKKGDIALPVPYDHQRGFS
GIFEDRSYICKTTIGDREVDSDAYYVYRLQVSSINVSVNAVQTVVRQGENITLMCIVIGN
EVVNFEWMYPRKESGRLVEPVTDFLLDMPYHIRSILHIPSAELEDSGTYTCNVTESVNDH
QDEKAINITVVESGYVRLLGEVGALQFAELHRSRTLQVVFEAYPPPTVLWFKDNRTLGDS
SAGEIALSTRNVSETRYVSELTLVRVKVAEAGHYTMRAFHEDAEVQLSFQLQINVPVRVL
ELSESHPDSGEQTVRCRGRGMPQPNIIWSACRDLKRCPRELPPMLLGNSSEEESQLETNV
TYWEEEQEFEVVSTLRLQHVDRPLSVRCTLRNAVGQDMQEVIVVPHSLPFKAVVISAILA
LVVLTIISLIILIMLWQKKPRYEIRWKVIESVSSDGHEYIYVDPMQLPYDSTWELPRDQL
VLGRTLGSGAFGQVVEATAHGLSHSQATMKVAVKMLKSTARSSEKQALMSELKIMSHLGP
HLNVVNLLGACTKGGPIYIITEYCRYGDLVDYLHRNKHTFLQHHSDKRRPPSAELYSNAL
PVGLPLPSHVSLTGESDGGYMDMSKDESVDYVPMLDMKGDVKYADIESSNYMAPYDNYVP
SAPERTCRATLINESPVLSYMDLVGFSYQVANGMEFLASKNCVHRDLAARNVLICEGKLV
KICDFGLARDIMRDSNYISKGSTFLPLKWMAPESIFNSLYTTLSDVWSFGILLWEIFTLG
GTPYPELPMNEQFYNAIKRGYRMAQPAHASDEIYEIMQKCWEEKFEIRPPFSQLVLLLER
LLGEGYKKKYQQVDEEFLRSDHPAILRSQARLPGFHGLRSPLDSSSVLYTAVQPNEGDND
YIIPLPDPKPEVADEGPLEGSPSLASSTLNEVNTSSTISCDSPLEPQEEPEPEPQLERQV
EPEPELEQLPDSGCPAPRAEAEDSFL
NT seq 3321 nt   +upstreamnt  +downstreamnt
atgcggcttccgggtgcgatgccagctctggccctcaaaggccagctgctgttgctgccc
ctgctgttactgctggaaccgcaggtctctcagggcctggtcatcacacccccggggcca
gagcttatcctcaatgtctccagcacctttgttctgacctgctcgggttcagctcccgtg
gtgtgggagcggatgtcccaggagctcccacaggaaatggccaaggcccaggacaatacc
ttctccagtgtgctgacactgaccaacctcactgggctagacacgggagaatacttttgc
acctacaatgactcccgtggactggagcctgatgagcggaaacggctctacatctttgtg
ccagatcccaccatgggcttcctccctaatgacgccgaggaactattcatctttcttacg
gaaataactgagatcaccattccatgccgagtaacagacccacaactggtggtgacactg
cacgagaagaaaggggacattgcactgcctgtcccctacgatcaccagcgtggcttttct
ggtatctttgaggacagaagctacatctgcaaaaccaccattggggacagggaggtggat
tccgacgcctactatgtctacagactccaggtgtcatccatcaacgtctccgtgaatgca
gtgcagacggtggtccgccagggtgagaacattaccctcatgtgcattgtgatcgggaat
gaggtggtcaacttcgagtggatgtacccccgcaaagaaagtgggcggctggtggagccg
gtgaccgacttcctcttggatatgccttaccacatccgctccatcctgcacatccccagt
gccgagttagaagactcggggacctacacctgcaatgtgacagagagtgtgaatgaccat
caggatgaaaaggccatcaacatcactgtggttgagagtggctacgtgcggctcctggga
gaggtgggagcactacaatttgctgagctgcaccggagccggacactgcaggtagtgttc
gaggcctaccctccgcccaccgtcctgtggttcaaagacaaccgcaccttgggcgactcc
agcgcaggcgagatcgccctgtccacgcgcaacgtgtcagagaccaggtatgtgtcagag
ctgacactcgttcgggtgaaggtggcagaggctggccactacaccatgcgggccttccat
gaggacgctgaggtccagctctccttccagctacagatcaatgtccctgtccgcgtgctg
gagctaagtgagagccacccagacagcggggaacagacagtccgctgtcgtggccggggc
atgccccagccgaacatcatctggtctgcctgcagagacctcaaaaggtgtccacgcgag
ctgccgcccatgctgctggggaacagttctgaagaggagagccagctggagacgaacgtg
acatactgggaggaggagcaggagtttgaggtggtgagcacactgcgtctgcagcacgtg
gatcggccactgtcggtgcgctgcacgctgcgcaacgctgtgggccaggacatgcaggag
gtcatcgtggtgccacactctttgcccttcaaggcggtggtgatctcagccatcctggcc
ctggtggtcctcaccatcatctcccttatcatcctcatcatgctttggcagaagaagcca
cgttacgagatccgatggaaggtgattgagtctgtgagctctgatggccatgagtacatc
tacgtggaccccatgcagctgccctatgactccacgtgggagctgccgcgggaccagctt
gtgctgggacgcaccctcggctctggggcctttgggcaggtggtggaggccacggctcat
ggcctgagccattctcaggccacgatgaaagtggccgtcaagatgcttaaatccacagcc
cgcagcagtgagaagcaagccctcatgtcggagctgaagatcatgagtcaccttgggccc
cacctgaacgtggtcaacctgttgggggcctgcaccaaaggaggacccatctatatcatc
actgagtactgccgctacggagacctggtggactacctgcaccgcaacaagcacacgttc
ctgcagcaccattccgacaagcgccgcccgcccagcgcggagctctacagcaatgcgttg
cccgttgggctccccctgcccagccacgtgtccctgactggggagagcgatggtggctac
atggacatgagcaaggacgagtcggtggactacgtgcccatgctggacatgaaaggagat
gtcaaatatgccgacatcgagtcctccaactacatggccccctacgataactacgttccc
tctgcccctgagaggacctgtcgagcaactttaatcaatgagtctccggtgctaagctac
atggaccttgtgggcttcagctaccaggtggccaatggcatggagttcctggcctccaag
aactgcgtgcaccgagacctggcggccaggaacgtgctcatctgcgagggcaagctggtc
aagatctgtgactttggcctggctcgagacatcatgcgggattcgaattacatctccaaa
ggcagtacctttttgcctttgaagtggatggctccagagagcatcttcaacagcctctac
accaccctgagcgacgtgtggtccttcgggatcctgctctgggagatcttcactttgggt
ggcaccccttacccagagctgcccatgaatgagcagttctacaatgccatcaaacggggt
taccgcatggcccagcctgcccacgcctccgacgagatctatgagatcatgcagaagtgc
tgggaagagaagtttgagattcggccccctttctcccagctggtgctgcttctcgagaga
ctgttgggcgaaggttacaaaaagaagtaccagcaggtggatgaggagtttctgaggagt
gaccacccagccatccttcggtcccaggcccgcttgcctgggttccatggcctccgatct
cccctggacagcagctccgtcctctataccgccgtgcagcccaatgagggtgacaacgac
tatatcatccccctgcctgaccccaaacccgaggttgctgacgagggcccactggagggt
tcccccagcctagccagctccaccctgaatgaagtcaacacctcctcgaccatctcctgt
gacagccctctggagccccaggaggaaccagagccagagccccagcttgagcgccaggtg
gaaccagagccagagctggaacagctgccggattcagggtgccccgcgcctcgagcggaa
gcagaggacagcttcctgtag

DBGET integrated database retrieval system