KEGG   Macaca mulatta (rhesus monkey): 711698
Entry
711698            CDS       T01028                                 

Gene name
RAPGEF5
Definition
(RefSeq) rap guanine nucleotide exchange factor 5
  KO
K08019  Rap guanine nucleotide exchange factor 5
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04014  Ras signaling pathway
mcc04015  Rap1 signaling pathway
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    711698 (RAPGEF5)
   04015 Rap1 signaling pathway
    711698 (RAPGEF5)
SSDB
Motif
Pfam: RasGEF RasGEF_N DEP RA
Other DBs
NCBI-GeneID: 711698
NCBI-ProteinID: NP_001181087
Ensembl: ENSMMUG00000002987
UniProt: H9G2F6
LinkDB
Position
3
AA seq 730 aa
MAIGVWQLLLDMGIMLSVDQHLYFQDTYVFYQFSSDECSYLYCEFEREEEWQNGVKLLLQ
LVPLIPARAGICELSHQKIEDSEESSDEILARLTSAVQRELAAVIALKARKSAIEQDEEN
NDKHVAVTEAESVPDSQAGVMCKLQERDEIGRIELVQKLARENYQFLQTDKKEQEKSEHQ
DDEVTTVQVKEQDQSVLVLKKVQCCGPAPTAGSAESHWRYVVVSGTPEKILEHLLNDLHL
EEVQDKETETLLDDFLLTYTVFMTTDDLCQALLRHYSAKKYQGKEENSDVPRRKRKVLHL
VSQWIALYKDWLHEDEHSKMFLKTIYRNVLDDVYEYPILEKELKEFQKILGMHRRHTVDE
YSPQKKNKALFHQFSLKENWLQHRGTVTETEEIFCHVYITEHSYVSVKAKVSSTAQEILK
FVAEKIQYAEEDLALVAITFSGGKHELQPNDLVISKSLEASGRIYVYRKDLADTLNPFAE
NEESQQRSMRILGMNTWDLALELMNFDWSLFNSIHEQELIYFTFSRQGSGEHTANLSLLL
QRCNEVQLWVATEILLCSQLGKRVQLVKKFIKIAAHCKAQRNLNSFFAIVMGLNTASVSR
LSQTWEKIPGKFKKLFSELESLTDPSLNHKAYRDAFKKMKPPKIPFMPLLLKDVTFIHEG
NKTFLDNLVNFEKLHMIADTVRTLRHCRTNQFGDLCPKEHQELKSYVNHLYVIDSQQALF
ELSHRIEPRV
NT seq 2193 nt   +upstreamnt  +downstreamnt
atggccataggagtctggcaactcctactggacatgggaattatgttatcagtggaccag
catctatactttcaagatacttatgttttctaccagttttcctctgatgaatgtagctac
ttgtactgtgaatttgaaagagaagaagaatggcaaaatggtgtcaagcttttactgcaa
cttgtgcctctcattcctgctagagctggcatctgtgagctgtctcatcagaaaattgaa
gactctgaagaaagcagtgatgaaattcttgcgcgtctaacatctgcggtgcagagagag
ctagcagctgtgattgctttgaaagcaaggaagtctgcaattgaacaagatgaagaaaac
aatgataaacatgtagctgtaacagaagccgaaagtgttccagattctcaggcaggggtg
atgtgcaagcttcaagaaagagatgaaatcggacgaattgaactagttcagaagctggca
agagaaaactatcagtttttgcagacggacaaaaaagaacaggagaagtctgaacaccaa
gatgatgaagtgacgactgttcaggttaaagagcaagaccagagcgtcctggtgctgaag
aaagtgcagtgctgtggcccagcccccacagctgggagtgcggagagccattggagatat
gtggtggtgtccgggaccccggagaagattttggagcaccttttgaatgacttgcacctg
gaagaagtccaggacaaagaaacagagaccctcctggatgacttccttctcacgtacact
gtcttcatgacaactgatgacttgtgccaggctctgttaaggcactattctgctaagaag
tatcaaggcaaagaggaaaactcagatgttcctcgtaggaaacgtaaagtcttgcatctt
gtttcccagtggattgctctgtacaaagactggttacatgaagatgaacattcaaaaatg
tttttaaagaccatatataggaatgtactggatgacgtttatgaatatccaatacttgaa
aaagaattgaaagaatttcaaaagatacttggaatgcaccgtcgtcacactgtggatgaa
tattcaccacaaaaaaagaataaagcccttttccaccaattcagtcttaaggagaactgg
ctccagcatagaggaactgtgactgaaacggaggaaattttctgccacgtgtatataaca
gagcactcctatgtcagtgtgaaggcaaaagtttccagtacagcccaagagatcctaaaa
ttcgtggcagaaaagatccagtatgccgaagaggatctggctctggtggccatcacattc
tctggaggaaagcatgaacttcagccgaatgacttagtcatctccaaatccctcgaggca
tctggtcggatatatgtctatcggaaagacctggcggacactttgaacccgtttgcagaa
aatgaggaatcacagcaaaggtcgatgaggattttgggaatgaacacttgggatcttgct
ctggaattaatgaattttgattggagtctattcaattcaattcacgagcaagagctgatc
tacttcacattcagcagacagggaagtggggaacacactgcaaacctcagccttctgctc
cagagatgcaatgaggtccagctctgggtggccacggagattctcctctgcagccagctg
ggcaagcgagtgcagctggtgaaaaaattcatcaaaattgcggctcactgcaaagcccag
agaaacctgaattctttctttgccatcgtgatgggtctcaacactgcttctgtcagtcga
ctgtcacagacctgggagaaaatccctgggaagtttaagaaacttttctctgaacttgaa
agtttaacagatccttccctaaatcacaaagcctacagagatgcattcaaaaagatgaag
ccaccaaaaatccctttcatgcccttattgcttaaagatgtaacatttattcatgaagga
aataaaacatttttggataatcttgtcaattttgaaaagctgcatatgatcgcagacact
gtccgaaccctgagacactgcaggactaaccagtttggtgacctgtgtccaaaagagcat
caagagttaaagtcctatgttaatcacctatatgtcattgacagccagcaggccctgttc
gagctctcacacaggatcgagcctcgggtgtga

DBGET integrated database retrieval system