KEGG   Macaca mulatta (rhesus monkey): 711825Help
Entry
711825            CDS       T01028                                 

Gene name
SETD2
Definition
(RefSeq) SET domain containing 2
  KO
K11423  histone-lysine N-methyltransferase SETD2 [EC:2.1.1.43]
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    711825 (SETD2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mcc03036]
    711825 (SETD2)
Enzymes [BR:mcc01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     711825 (SETD2)
Chromosome and associated proteins [BR:mcc03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     711825 (SETD2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SRI SET AWS WW
Motif
Other DBs
NCBI-GeneID: 711825
NCBI-ProteinID: XP_001113652
Ensembl: ENSMMUG00000021117
UniProt: H9FTE9
LinkDB All DBs
Position
2
AA seq 2565 aa AA seqDB search
MKQLQPQPPPKMGDFYDPEHPTPEEEENEAKIENVQKTGFIKGPMFKGVASSRFLPKGTK
TKVNLEEQGRQKVSFSFSLTKKTLQNRFLTALGNEKQSDTPNPPAVPLQVDSTPKMKMEI
GDTLSTAEESSPPKSRVELGKIHFKKHLLHVTSRPLLATTTAVASPPTHAAPLPAVIAES
TTVDSPPSSPPPPPPPAQATTPSSPAPITEPVALPHTPVTVLMAAPVPLPVDVAVRSLKE
PPIIIVPESLEADTKQDTVSNSSEEHITQILNEQADISSKKEDSHIGKDEEIPDSSKISL
SCKKTGSKKKSSQSEGTFLGSESDEDSVRTSSSQRSHDLKFSASIERERDFKKSSAPLKS
EDLGKSSRSKTERDDKYFSYSKLERDTRYVSSRCRSERERRRSRSHSRSERGPRTNLSYS
RSERSHYYDSDRRYHRSSPYRERTRYSRPYTDNRARESSDSEEEYKKTYSRRTSSHSSSY
RDLRTSSYSKSDRDCKTETSYLEMERRGKYSSKLERESKRTSENEAVKRCCSPPNELGFR
RGSSYSKHDSSASRYKSTLSKPIPKSDKFKNSFCCTELNEEIKQSHSFSLQTPCSKGSEL
RMINKNPEREKAGSPAPSNRLNDSPTLKKLDEFPIFKSEFITHDSHDRIKELDSLSKVRN
DQLRSFCPIELNINGSPGAESDLATFCTSKTDAVLMTSDDSVTGSEVSPLVKACMLSSNG
FQNISRCKGKDLDDTRMLHKKSESPFRETEPLVSPHQDKLMSLPVMTIDYSKTVVKEPVD
TRVSCCKTKDSDIYCTSNDSNNPSLCNSEAENIEPSVMKISSNSFMNVHLESKPVICDSR
NLTDHSKFACEEYKQSIGSTSSASVNHFDDLYQPIGSSDIASSLQSLPPGIKVDSLTLLK
CGENTSPVLDAVLKSRKSSEFLKHAGKETVVEVGSDLPDSGKGFASRENRRNNGLSGKCL
QEAQEEGNSILPDRRGRPEISLHERGEGGRVHTSDDSEVVFSSCDLNLTMEDSDGVTYAL
KCDSSGHAPEIVSTAHEDYSDSSESSSDESDSEDTDSDDSSIPRNRLQSVVVVPKNSTLP
VEETSPCSSRSSQSYRHYSDHWEDERLESRRHSYEEKFESIANKACPQTDKFFLHKGTEK
NPEISFTQSNRKQIDNHLPELSHPQSDGVDSTSHTDVKSDSLGHPNSEETVKAKISSRQQ
EELPIYSSDFEDVPNKSWQQSTFQNRPDSRLGKTELSFSSSCEISRVDGLHSSEELRNLG
WDFSQEKPSTTYQQPDSSYGTCGGHKYQQNAEQYGGTRDYWQGNGYWDPRSGRPPGTGVV
YDRTQGQVPDSLTDDREEEENWDQQDGSHFSDQSNKYLLSLQKDKGSVQAPEISSNSIKD
TLAVNEKKEFSKNLEKNDIKDRGPLKKRRQEIESDSESDGELQDRKKVRVEVEQGETSVP
PGSALVGPSCVMDDFRDPQRWKECAKQGKMPCYFDLIEENVYLTERKKNKSHRDIKRMQC
ECTPLSKDERAQGEIACGEDCLNRLLMIECSSRCPNGDYCSNRRFQRKQHADVEVILTEK
KGWGLRAAKDLPSNTFVLEYCGEVLDHKEFKARVKEYARNKNIHYYFMALKNDEIIDATQ
KGNCSRFMNHSCEPNCETQKWTVNGQLRVGFFTTKLVPSGSELTFDYQFQRYGKEAQKCF
CGSANCRGYLGGENRVSIRAAGGKMKKERSRKKDSVDGELEALMENGEGLSDKNQVLSLC
RLMVRIETLEQKLTCLELIQNTHSQSCLKSFLERHGLSLLWIWMAELGDGRESNQKLQEE
IIKTLEHLPIPTKNMLEESKVLPIIQRWSQTKTAVPPLSEGDGYSSENTSRAHTPLNTPD
PSTKLSTEADTDTPKKLMFRRLKIISENSMDSAISDATSELEGKDGKEDLDQLENVPVEE
EEELQSQQLLPQQLPECKVESETNIEASKLPTSEPEADTEIEPKESNGTKLEEPINEETP
SQDEEEGVSDVESERSQEQPDKTVDISDLATKLLDSWKDLKEVYRIPKKSQTEKENTTAE
RGRDAVGFRDQTPAPKTPNRSRERDPEKQTQNKEKRKRRGSLSPPPSAYERGTKRPDDRY
DTPTSKKKVRIKDRNKLSTEERRKLFEQEVAQREAQKQQQQMQNLGMTSPLPYDSLGYNA
PHHPFAGYPPGYPMQAYVDPSNPNAGKVLLPTPSMDPVCSPAPYDHAQPMVGHSTEPLSA
PPPVPVVPHVAASVEVSSSQYVAQSEGVVHQDSSVAVLPVPAPGPVQGQNYSVWDSNQQS
VSVQQQYSPAQSQATIYYQGQTCPAVYGVTSPYSQTTPPIVQSYAQPSLQYIQGQQIFTA
HPQGVVVQPAAAVTTIVAPGQPQPLQPSEMVVTNNLLDLPPPSPPKPKTIVLPPNWKTAR
DPEGKIYYYHVITRQTQWDPPTWESPGDDASLEHEAEMDLGTPTYDENPMKTSKKPKTAE
ADTSSELAKKSKEVFRKEMSQFIVQCLNPYRKPDCKVGRITTTEDFKHLARKLTHGVMNK
ELKYCKNPEDLECNENVKHKTKEYIKKYMQKFGAVYKPKEDTELE
NT seq 7698 nt NT seq  +upstreamnt  +downstreamnt
atgaagcagctgcagccgcagccgcctccgaagatgggggatttctacgacccggagcac
ccgacccctgaagaagaagaaaatgaggcaaagattgaaaatgtgcagaaaacaggtttc
atcaaaggaccaatgttcaaaggtgttgcttctagtcgatttttgcccaaaggcaccaag
acaaaagttaatttggaagaacagggacgacagaaggtgtcattcagcttcagccttaca
aagaaaactttgcagaataggtttctcactgcacttggcaatgaaaagcaaagtgatact
ccaaaccccccagctgtacctcttcaggtagactcgactcctaaaatgaaaatggaaatt
ggtgataccttatctactgcagaagaatcttccccaccaaagtcaagggtggaattgggc
aaaattcattttaagaaacacctgcttcatgtaacatccaggccattgctggctactacc
acagcagtagcatctccacctactcatgcagcaccactaccagcagtgatagcagaatca
acaactgtagactcaccaccctcatctccacctccaccgcctccacctgcccaagccaca
acaccctcatcaccagcaccaataacagagccagtggccttgccacatacaccagtaaca
gttctaatggcagcaccagtacccttaccagtagatgtagcagttagatctctgaaagaa
ccaccaattataattgtaccagaatctttagaagcagatactaagcaggacactgtatct
aatagttcagaagaacacataactcaaatattgaatgagcaagcagatatttcctcaaaa
aaagaagattcccatattgggaaggatgaagaaattccagatagttctaagattagtctg
agctgtaaaaaaacaggttctaagaagaaatcctcacaatctgaaggcacctttcttggt
tcagaatctgatgaagattctgtacggacttcttcaagtcaaagatcacatgatttaaaa
ttttcagcaagcattgaaagggaaagagattttaaaaagagctcagcacctttaaaaagt
gaggatctagggaaatcttcacgatctaaaacagagagagatgataaatattttagctat
tcaaaacttgaaagagatactcggtatgtatcttcccgatgtagatcagaaagagagcga
cggcggagcagatctcattctaggtctgagagaggccctagaactaatttatcctattcc
aggtcagaacgatctcattattatgactctgatcgtcgctaccataggagctccccttat
cgagagaggacacgctattctcggccatacacagataacagagcacgagagagttctgac
tcagaagaagagtataagaagacatactcaaggcgtacctcatctcattcctcttcttac
agagacctaaggacatcatcctattctaaatctgatcgggactgtaaaactgagacctct
tacttagagatggaaagaagaggcaagtattcttcaaaactagaaagagaatctaaaagg
acttcagaaaatgaagcagttaaaagatgttgttctccccctaatgaactgggattccga
cgagggtcatcatattctaagcacgacagtagtgcttcccgttataaatctaccctttca
aaacctatacccaagtctgataaatttaaaaattctttctgttgtacagaattaaatgaa
gaaatcaaacagtctcattcttttagtttacagacaccttgttcaaaaggtagtgaatta
agaatgattaataaaaaccctgaaagagaaaaggctgggtctccagctccatcaaatcga
ttaaatgattcacctactttaaaaaagctagatgaatttcctatttttaagtctgaattt
ataacacatgatagccatgataggattaaggaattagactctttatctaaagtgaggaat
gatcaattaagaagtttttgtcccatagaattaaatataaatggatctcctggggcagaa
tctgatttagcaacattttgcacttctaaaactgatgctgttttaatgacttctgatgat
agtgtgactggatcggaagtatcccctttggtcaaagcatgcatgctttcatcaaatgga
tttcagaatattagtagatgcaaaggaaaagacttggatgatacacgcatgctgcataag
aagtcagaaagcccatttagagaaacagaacctctggtgtcaccacaccaagataaactc
atgtctttgccagttatgactatagattattccaaaactgtagttaaagaaccagttgat
acgagggtttcttgctgcaaaaccaaagattcagacatatactgtacttcaaatgatagc
aacaacccttctttgtgtaactccgaagctgaaaatatagagccttcagttatgaagatt
tcttcaaatagctttatgaatgtgcatttggaatcaaaaccagttatatgtgatagtaga
aatttgacagatcactcaaaatttgcatgtgaagaatataagcagagcatcggtagcact
agttcagcttctgttaatcattttgatgatttatatcagcctattgggagttcagatatt
gcttcatctcttcagagtcttccaccaggaataaaggtggacagtctaactctcttgaaa
tgtggagagaacacatctccagttctggatgcagtgctaaagagtagaaaaagttcggag
tttttaaagcatgcagggaaagaaacagtagtagaagtaggtagtgaccttcctgattca
ggaaagggatttgcttccagggagaacaggcgtaataatgggttatctgggaaatgtttg
caagaggctcaagaagaagggaattccatattgcctgatagaagaggaagaccagaaatc
tctttacatgaaagaggagaaggaggacgtgtgcatacttctgatgactcagaagttgta
ttttcttcttgtgatttgaatttaaccatggaagacagtgatggtgtaacttacgcatta
aagtgtgacagtagtggtcatgccccagaaattgtgtctactgcccatgaagattattct
gactcttctgaaagttcaagtgatgaaagtgattcagaagatacagattcagatgatagc
agtattccaagaaaccgtctccagtctgttgtggttgtgccaaagaattctactttgccc
gtggaagaaacaagtccttgttcttctcggagcagtcaaagttatagacactattctgac
cattgggaagatgaaagattggagtcaaggagacattcatatgaggaaaaatttgaaagt
atagcaaataaagcctgtcctcaaactgataagtttttccttcataaaggaacagagaag
aatccagaaatttcttttacacagtccaatagaaaacaaatagataaccacctgcctgaa
ctttctcatcctcagagtgatggggttgatagtacaagtcatacagatgtgaaatctgac
tctctgggtcacccaaattcagaggaaactgtgaaagccaaaatatcttctaggcagcaa
gaggagctgccaatttattcttctgattttgaagatgtcccaaataagtcttggcaacag
tccactttccaaaacaggccagatagtagactgggaaaaacagaattgagtttttcttcc
tcttgtgagatatcacgtgtggatggcttgcactcatcagaagagctcagaaacttaggt
tgggacttctctcaagaaaagccttctaccacatatcagcaacctgacagtagctatgga
acttgtggtggacacaagtatcagcaaaatgcagaacagtatggtgggacacgtgattac
tggcaaggcaatggttactgggatccgagatcaggtagacctcctggaactggggttgtg
tatgatcgaactcaaggacaagtaccagattccctaacagatgatcgtgaagaagaggag
aattgggatcaacaggatggatcccatttttcagaccagtccaataagtatcttctatcc
cttcagaaagacaaggggtcagtgcaagcacctgaaataagcagcaattccattaaggac
actttagctgtgaatgaaaagaaagagttttcaaaaaacttagaaaaaaatgatatcaaa
gatagagggcctcttaaaaaaaggaggcaggaaatagagagtgattctgaaagtgatggt
gagcttcaggacagaaagaaagttagagtggaggtagaacagggagagacatcagtgccc
ccaggctcagcactggttgggccctcctgtgtcatggatgacttcagggacccacagcga
tggaaggaatgtgccaagcaagggaaaatgccttgttactttgatcttattgaagaaaat
gtttatttaacagaaagaaagaagaataaatctcatcgagatattaagcgaatgcagtgt
gagtgtacacctctttctaaagatgaaagagctcaaggtgaaatagcatgtggagaagat
tgtcttaatcgtcttctcatgattgaatgttcttctcggtgtccaaatggggattattgt
tccaatagacggtttcagagaaaacagcatgcagatgtggaagtcatactcacagaaaag
aaaggctggggcttgagagctgccaaagaccttccttcgaacacctttgtcctagaatat
tgtggagaggtactcgatcataaagagtttaaagctcgagtaaaggagtatgcacgaaac
aaaaacatccattactatttcatggccctgaagaatgatgagataatagatgccactcaa
aaaggaaattgctctcgtttcatgaatcacagctgtgaaccaaactgtgaaacccaaaaa
tggactgtgaacggacaactgagggttgggttttttaccaccaaactggttccttcaggc
tcagagttaacatttgactatcagttccagagatatggaaaagaagcccagaaatgtttc
tgtggatcagccaattgccggggttacctgggaggagaaaacagagtcagcatcagagca
gcaggagggaaaatgaagaaggaacgatcccgtaagaaggattcagtggatggagagcta
gaagctctgatggaaaatggtgagggtctctctgataaaaaccaggtgctcagcttatgc
cggctaatggttagaattgaaactttggagcagaaacttacctgtctggaactcatacag
aacacacactcacagtcctgcctgaagtcctttctggaacgtcatgggctgtctttgttg
tggatctggatggcagagctaggtgacggccgggaaagtaaccagaagcttcaggaagag
attataaagactttggaacacttgcccattcctactaaaaatatgttggaggaaagcaaa
gtacttccaattattcaacgctggtctcagactaagactgctgtccctccgttgagtgaa
ggagatgggtattctagtgagaatacatcgcgtgctcacacaccactcaacacacctgat
ccttccaccaagctgagcacagaagctgacacagacactcccaagaaactaatgtttcgc
agactgaaaattataagtgaaaatagcatggacagtgcaatctctgatgcaaccagtgag
ctagaaggcaaggatggcaaagaggatcttgatcaattagaaaatgttcctgtagaggaa
gaggaagagttgcagtcacaacagctactaccacaacagctgcctgaatgcaaagttgag
agtgaaaccaacatagaagctagtaagctacctacgtctgaaccagaagctgacactgaa
atagagcccaaagagagcaatggcacaaaactagaagaacctattaatgaagaaacacca
tcccaagatgaagaagagggtgtgtctgatgtggagagtgaaaggagccaagaacagcca
gataaaacagtggatataagtgatttggccaccaaactcctggacagttggaaagatcta
aaggaggtatatcgaattccaaagaaaagtcaaactgaaaaggagaacacaacagctgaa
cgaggaagggatgctgttggcttcagagatcaaacacctgccccaaagactcctaatagg
tcaagagagagagacccagagaagcaaactcaaaataaagagaaaaggaaacgaagaggc
tccctctcaccaccaccttctgcctatgagcggggaacaaaaaggccagatgacagatat
gatacaccaacttctaaaaagaaagtacgaattaaagaccgcaataaactttctacagag
gaacgccggaagttgtttgagcaagaggtggctcaacgggaggctcagaaacaacagcaa
cagatgcagaacctgggaatgacatcaccactgccctatgactctcttggttataacgcc
ccacatcatccctttgctggttacccaccaggttatcccatgcaggcctatgtggatccc
agcaaccctaatgctggaaaggtgctcctgcccacacccagcatggacccagtgtgttct
ccagctccttatgatcatgctcagcccatggtgggacattctacagaacccctttctgcc
ccaccaccagtaccagtggtgccacatgtggcagcttctgtggaagtttccagttcccag
tatgtggcccagagtgaaggtgtagtacaccaagactccagcgttgctgtcttgccagtg
ccggcccccggcccagttcagggacagaattacagtgtctgggattcaaaccagcagtct
gtcagtgtacagcagcagtactctcctgcacagtctcaagcaaccatatattatcaagga
cagacatgtccagcagtctatggtgtgacatcaccttattcacagacaactccaccaatt
gtacagagttatgcccagccaagtcttcagtatatccaggggcaacagattttcacagct
catccacaaggagtagtggtacagccagccgcagcagtgactacaatagttgcaccagga
cagcctcagcccttgcagccatctgaaatggttgtgacaaataatctcttggatctgccg
cccccctctccacccaaaccaaaaaccattgtcttacctcccaattggaagacagcccga
gatccagaagggaagatttattactaccatgtgatcacaaggcagactcagtgggatcct
cctacttgggaaagtccaggagatgatgccagccttgagcatgaagctgagatggacctg
ggaactccaacatatgatgaaaaccccatgaagacttcgaaaaagcccaagacagcagaa
gcagacacctccagtgaactagcaaagaaaagcaaagaagtattcagaaaagagatgtcc
cagttcatcgtccagtgcctgaacccttaccggaaacctgactgtaaagtgggaagaatt
accacaactgaagactttaaacatctggctcgcaagctgactcacggtgttatgaataag
gagctgaagtactgtaagaatcctgaggacctggagtgcaatgagaatgtgaaacacaaa
accaaggagtacattaagaagtacatgcaaaagtttggggctgtttacaaacccaaagag
gacactgagttagagtga

DBGET integrated database retrieval system