KEGG   Macaca mulatta (rhesus monkey): 711922Help
Entry
711922            CDS       T01028                                 

Gene name
HK1
Definition
(RefSeq) hexokinase 1
  KO
K00844  hexokinase [EC:2.7.1.1]
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc00010  Glycolysis / Gluconeogenesis
mcc00051  Fructose and mannose metabolism
mcc00052  Galactose metabolism
mcc00500  Starch and sucrose metabolism
mcc00520  Amino sugar and nucleotide sugar metabolism
mcc00524  Neomycin, kanamycin and gentamicin biosynthesis
mcc01100  Metabolic pathways
mcc01200  Carbon metabolism
mcc04066  HIF-1 signaling pathway
mcc04910  Insulin signaling pathway
mcc04930  Type II diabetes mellitus
mcc04973  Carbohydrate digestion and absorption
mcc05230  Central carbon metabolism in cancer
Module
mcc_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
mcc_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    711922 (HK1)
   00051 Fructose and mannose metabolism
    711922 (HK1)
   00052 Galactose metabolism
    711922 (HK1)
   00500 Starch and sucrose metabolism
    711922 (HK1)
   00520 Amino sugar and nucleotide sugar metabolism
    711922 (HK1)
  09110 Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    711922 (HK1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04066 HIF-1 signaling pathway
    711922 (HK1)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    711922 (HK1)
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    711922 (HK1)
 09160 Human Diseases
  09161 Cancers: Overview
   05230 Central carbon metabolism in cancer
    711922 (HK1)
  09167 Endocrine and metabolic diseases
   04930 Type II diabetes mellitus
    711922 (HK1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mcc04131]
    711922 (HK1)
Enzymes [BR:mcc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     711922 (HK1)
Membrane trafficking [BR:mcc04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    711922 (HK1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hexokinase_2 Hexokinase_1 CSD
Motif
Other DBs
NCBI-GeneID: 711922
NCBI-ProteinID: XP_015002974
Ensembl: ENSMMUG00000015302
UniProt: F6Q724
LinkDB All DBs
Position
9
AA seq 921 aa AA seqDB search
MGQICQRESATAAKKLKSHPLDESEIDKYLYAMRLSDETLIDIMTRFKKEMKNGLSRDFN
PTATVKMLPTFVRSIPDGSEKGDFIALDLGGSSFRILRVQVNHEKNQNVHMESEVYDTPE
NIVHGSGSQLFDHVAECLGDFMEKRKIKDKKLPVGFTFSFPCQQSKIDEAILITWTKRFK
ASGVEGADVVKLLNKAIKKRGDYDANIVAVVNDTVGTMMTCGYDDQQCEVGLIIGTGTNA
CYMEELRHIDLVEGDEGRMCINTEWGAFGDDGSLEDIRTEFDREIDRGSLNPGKQLFEKM
VSGMYLGELVRLILVKMAKEGLLFEGRITPELLTRGKFNTSDVSAIEKNKEGLHNAKEIL
TRLGVEPSDDDCVSVQHVCTIVSFRSANLVAATLGAILNRLRDNKGTPRLRTTVGVDGSL
YKTHPQYSRRFHKTLRRLVPDSDVRFLLSESGSGKGAAMVTAVAYRLAEQHRQIEETLAH
FHLTKDMLLEVKKRMRAEMELGLRKQTHNNAVVKMLPSFVRSTPDGTENGDFLALDLGGT
NFRVLLVKIRSGKKRTVEMHNKIYAIPIEIMQGTGEELFDHIVSCISDFLDYMGIKGPRM
PLGFTFSFPCQQTSLDAGILITWTKGFKATDCVGHDVATLLRDAIKRREEFDLDVVAVVN
DTVGTMMTCAYEEPTCEVGLIVGTGSNACYMEEMKNVEMVEGDQGLMCINMEWGAFGDNG
RLDDIRTQYDRLVDEYSLNAGKQRYEKMISGMYLGEIVRNILIDFTKKGFLFRGQISEPL
KTRGIFETKFLSQIESDRLALLQVRAILQQLGLNSTCDDSILVKTVCGVVSRRAAQLCGA
GMAAVVDKIRENRGLDRLNVTVGVDGTLYKLHPHFSRIMHQTVKELSPKCNVSFLLSEDG
SGKGAALITAVGVRLRTEASS
NT seq 2766 nt NT seq  +upstreamnt  +downstreamnt
atggggcagatctgccagcgagaatcggctacagcagctaaaaaactaaaatctcatcca
cttgatgaaagtgagattgacaagtatctctatgccatgcggctgtccgatgaaactctc
atagatatcatgactcgcttcaagaaggaaatgaagaatggcctctcccgggattttaat
ccaacagccacagtcaagatgttgccaacattcgtaagatccattcccgatggctctgaa
aagggagatttcattgccctggatcttggtgggtcttcctttcgaattctgcgggtgcaa
gtgaatcatgagaaaaaccagaatgttcacatggagtccgaggtttatgacaccccagag
aacatcgtgcacggcagtggaagccagctttttgatcatgttgctgagtgcctgggagat
ttcatggagaaaaggaagatcaaggacaaaaagttacctgtgggattcacattttctttt
ccttgccaacaatccaaaatagatgaggccatcctgatcacctggacaaagcgatttaaa
gcaagtggagtggaaggagcggatgtggtcaagctgcttaacaaagccatcaaaaagcga
ggggactatgatgccaacatcgtagctgtggtgaatgacacagtgggcaccatgatgacc
tgtggctatgacgaccagcagtgtgaagttggcctgatcatcggtactggcaccaatgct
tgctacatggaggaactgaggcacattgatctggtggaaggagacgaggggaggatgtgt
atcaacacagaatggggagcctttggagatgatggatcattagaagacatccggacagag
tttgaccgggagattgaccggggatccctcaaccctggaaaacagctgtttgagaagatg
gtcagtggcatgtacttgggagagctggttcgactgatcctggtcaagatggccaaggag
ggcctcttgtttgaagggcggatcaccccggagctgctcaccagagggaagtttaacacc
agtgatgtgtcagccattgaaaagaataaggaaggcctccacaatgccaaagaaatcctg
acccgcctgggagtggagccgtccgatgatgactgtgtctcggtccagcacgtttgcacc
attgtctcgtttcgctcagccaacctggtggctgctacactgggcgccatcttgaaccgc
ctgcgtgataacaagggcacacccaggctacggaccacggttggtgtcgacggatctctt
tacaagacgcacccacagtattcccggcgtttccacaagactctgaggcgcttggtgccg
gactccgatgtgcgtttcctcctctcggagagtggcagcggcaagggggctgccatggtg
acagcggtggcctaccgcttggccgagcagcaccggcaaatagaggagaccctggctcat
ttccacctcaccaaggacatgctgctggaggtgaagaagaggatgcgggccgagatggag
ctggggctgaggaagcagacgcacaacaatgccgtggttaagatgctgccctccttcgtc
cggagtacccctgacgggaccgagaatggtgacttcttggccctggatcttggaggaacc
aatttccgtgtgctgctggtgaaaatccgtagtgggaaaaagagaacggtggaaatgcac
aacaagatctacgccattcctattgaaatcatgcagggcactggggaagagctgtttgat
cacattgtctcctgcatctctgacttcctggactacatggggatcaaaggccctaggatg
cctctgggcttcacgttctcatttccctgccagcagacgagtctggacgcgggaatcttg
atcacgtggacaaagggttttaaggcaacagactgcgtgggccatgatgtagccacctta
ctaagggatgcgataaaaaggagagaggaatttgacctggacgtggtggctgtggtcaac
gacacagtgggcaccatgatgacctgtgcttatgaggagcccacctgtgaggtcggactc
attgttgggactggcagcaatgcctgctacatggaggagatgaagaatgtggagatggtg
gagggagaccaggggctgatgtgcatcaacatggagtggggggcctttggggacaatggg
cgtctggatgatatcaggacacagtacgacagactggtggatgaatattccctaaatgcc
gggaaacaaaggtatgagaagatgatcagtggtatgtacctgggtgaaatcgtccgcaac
atcttaattgacttcaccaagaagggattcctcttccgagggcagatctcagagccgctg
aagacccggggcatctttgagaccaagtttctctctcagatcgaaagtgaccgattagca
ctgctccaggtccgggccatcctccagcagctgggtctgaatagcacctgcgatgacagt
atcctcgtcaagaccgtgtgtggggtggtgtccaggagggccgcgcagctgtgtggcgca
ggcatggctgcggtggtggataagatccgagagaacagaggactggaccgtctgaacgtg
actgtgggagtggacgggacgctctacaagcttcatccgcacttctccagaatcatgcac
cagacggtgaaggaactatcaccaaaatgtaacgtgtccttccttctgtctgaggatggc
agcggcaagggagccgccctcatcacggccgtgggcgtgcggttacgcacagaggcaagc
agctaa

DBGET integrated database retrieval system