KEGG   Macaca mulatta (rhesus monkey): 711927
Entry
711927            CDS       T01028                                 

Gene name
OTUD5
Definition
(RefSeq) OTU domain-containing protein 5 isoform X1
  KO
K12655  OTU domain-containing protein 5 [EC:3.4.19.12]
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04622  RIG-I-like receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09150 Organismal Systems
  09151 Immune system
   04622 RIG-I-like receptor signaling pathway
    711927 (OTUD5)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:mcc01002]
    711927 (OTUD5)
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:mcc04121]
    711927 (OTUD5)
Enzymes [BR:mcc01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     711927 (OTUD5)
Peptidases and inhibitors [BR:mcc01002]
 Cysteine peptidases
  Family C85
   711927 (OTUD5)
Ubiquitin system [BR:mcc04121]
 Deubiquitinating enzyme (DUB)
  Ubiquitin-specific proteases (UBPs)
   OTU
    711927 (OTUD5)
SSDB
Motif
Pfam: OTU Peptidase_C65
Other DBs
NCBI-GeneID: 711927
NCBI-ProteinID: XP_014982863
Ensembl: ENSMMUG00000004558
LinkDB
Position
X
AA seq 572 aa
MTILPKKKPPPPDADPANEPPPPGPLPPAPRRGGGVGVGGGGTGVGGGDRDRDSGVVGAR
PRASPPPQGPLPGPPGALHRWALAVPPGAVAGPRPQQASPPPCGGPGGPGGGPGDALGAA
AAGVGAAGVVVGVGGAVGVGGCCSGPGHSKRRRQAPGVGAVGGGSPEREEVGAGYNSEDE
YEAAAARIEAMDPATVEQQEHWFEKALRDKKGFIIKQMKEDGACLFRAVADQVYGDQDMH
EVVRKHCMDYLMKNADYFSNYVTEDFTTYINRKRKNNCHGNHIEMQAMAEMYNRPVEVYQ
YSTGTSAVEPINTFHGIHQNEDEPIRVSYHRNIHYNSVVNPNKATIGVGLGLPSFKPGFA
EQSLMKNAIKTSEESWIEQQMLEDKKRATDWEATNEAIEEQVARESYLQWLRDQEKQARQ
VRGPSQPRKASATCSSATAAASSGLEEWTSRSPRQRSSASSPEHPELHAELGIKPPSPGT
VLALAKPPSPCAPGTSSQFSAGADRATSPLVSLYPALECRALIQQMSPSAFAGLNDWDDD
EILASVLAVSQQEYLDSMKKNKVHRDPPPDKS
NT seq 1719 nt   +upstreamnt  +downstreamnt
atgactatactccccaaaaagaagccgccgcctcccgacgccgaccccgccaacgagccg
ccgccgcccgggccgctgcccccggcgccgcggcgcggcgggggtgtgggcgtgggcggc
ggcggcacgggcgtgggcggcggcgatcgcgaccgtgactccggcgtcgtgggggcccgt
ccgcgagcttcgccaccgcctcaaggcccgctaccaggaccgccgggcgcacttcatcgc
tgggcgctggccgtgccgcctggtgcagtggcgggtccccggccacaacaggcttctcca
cctccttgcgggggcccaggtggtcccggcggcggtcccggcgacgcgctgggcgcagcg
gcggcgggtgtgggtgccgcgggcgtggtggtgggtgtgggtggtgccgtaggcgtgggc
ggctgctgctccgggcctgggcacagcaagcggcgacgtcaagctcccggggttggcgcg
gttggcgggggcagtcccgagcgtgaggaggtcggcgcaggctacaacagtgaggacgag
tatgaggcggctgcagcacgcatcgaggctatggaccctgccactgtcgagcagcaggag
cattggtttgaaaaggccctacgagacaagaagggcttcatcatcaagcagatgaaggag
gatggcgcctgtctcttccgggctgtagctgaccaggtgtatggagaccaggacatgcat
gaggttgtgcgaaagcattgcatggactatctgatgaagaatgccgactacttctccaac
tatgtcacagaggactttaccacctacattaaccggaagcgaaaaaacaattgccatggc
aaccacattgagatgcaggccatggcagagatgtacaaccgtcctgtggaggtgtaccag
tacagcacaggtacttctgcagtggaacccatcaacacattccatgggatacatcaaaac
gaggacgaacccattcgtgtcagctaccatcggaatatccactataattcagtggtgaat
cctaacaaggccaccattggtgtggggctgggcctgccatcattcaaaccagggtttgca
gagcagtctctgatgaagaatgccataaaaacatcggaggagtcatggatcgaacagcag
atgctagaagacaagaaacgggccacggactgggaggccacaaatgaggccattgaggag
caggtggctcgggaatcctacctgcagtggttgcgggatcaggagaaacaggcccgccag
gtccgcggccccagccagccccggaaagccagcgccacatgcagttcggccacagcagca
gcctccagtggcctggaggagtggactagccggtccccacggcagcggagttcagcctca
tcacctgagcatcctgagctgcatgctgaattgggcatcaagcccccttccccaggcact
gttttagctcttgccaaacctccttcgccctgtgcgccaggtacaagcagtcagttctcg
gcaggggccgaccgggcaacttccccccttgtgtccctctaccctgctttggagtgccgg
gccctcattcagcagatgtccccctctgcctttgcaggtctgaatgactgggatgatgat
gagatcctagcgtcggtgctggcagtgtcccaacaggaatacctagacagtatgaagaaa
aataaagtgcacagagacccgcccccagacaagagttga

DBGET integrated database retrieval system