KEGG   Macaca mulatta (rhesus monkey): 711979
Entry
711979            CDS       T01028                                 

Gene name
RPS6KB1
Definition
(RefSeq) ribosomal protein S6 kinase beta-1 isoform X1
  KO
K04688  ribosomal protein S6 kinase beta [EC:2.7.11.1]
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc01521  EGFR tyrosine kinase inhibitor resistance
mcc01522  Endocrine resistance
mcc04012  ErbB signaling pathway
mcc04066  HIF-1 signaling pathway
mcc04140  Autophagy - animal
mcc04150  mTOR signaling pathway
mcc04151  PI3K-Akt signaling pathway
mcc04152  AMPK signaling pathway
mcc04211  Longevity regulating pathway
mcc04213  Longevity regulating pathway - multiple species
mcc04350  TGF-beta signaling pathway
mcc04371  Apelin signaling pathway
mcc04666  Fc gamma R-mediated phagocytosis
mcc04714  Thermogenesis
mcc04910  Insulin signaling pathway
mcc04931  Insulin resistance
mcc05163  Human cytomegalovirus infection
mcc05165  Human papillomavirus infection
mcc05170  Human immunodeficiency virus 1 infection
mcc05200  Pathways in cancer
mcc05205  Proteoglycans in cancer
mcc05210  Colorectal cancer
mcc05212  Pancreatic cancer
mcc05221  Acute myeloid leukemia
mcc05224  Breast cancer
mcc05225  Hepatocellular carcinoma
mcc05226  Gastric cancer
mcc05231  Choline metabolism in cancer
mcc05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    711979 (RPS6KB1)
   04350 TGF-beta signaling pathway
    711979 (RPS6KB1)
   04371 Apelin signaling pathway
    711979 (RPS6KB1)
   04066 HIF-1 signaling pathway
    711979 (RPS6KB1)
   04151 PI3K-Akt signaling pathway
    711979 (RPS6KB1)
   04152 AMPK signaling pathway
    711979 (RPS6KB1)
   04150 mTOR signaling pathway
    711979 (RPS6KB1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    711979 (RPS6KB1)
 09150 Organismal Systems
  09151 Immune system
   04666 Fc gamma R-mediated phagocytosis
    711979 (RPS6KB1)
  09152 Endocrine system
   04910 Insulin signaling pathway
    711979 (RPS6KB1)
  09149 Aging
   04211 Longevity regulating pathway
    711979 (RPS6KB1)
   04213 Longevity regulating pathway - multiple species
    711979 (RPS6KB1)
  09159 Environmental adaptation
   04714 Thermogenesis
    711979 (RPS6KB1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    711979 (RPS6KB1)
   05205 Proteoglycans in cancer
    711979 (RPS6KB1)
   05231 Choline metabolism in cancer
    711979 (RPS6KB1)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    711979 (RPS6KB1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    711979 (RPS6KB1)
   05212 Pancreatic cancer
    711979 (RPS6KB1)
   05225 Hepatocellular carcinoma
    711979 (RPS6KB1)
   05226 Gastric cancer
    711979 (RPS6KB1)
   05221 Acute myeloid leukemia
    711979 (RPS6KB1)
   05224 Breast cancer
    711979 (RPS6KB1)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    711979 (RPS6KB1)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    711979 (RPS6KB1)
   05163 Human cytomegalovirus infection
    711979 (RPS6KB1)
   05165 Human papillomavirus infection
    711979 (RPS6KB1)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    711979 (RPS6KB1)
   01522 Endocrine resistance
    711979 (RPS6KB1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mcc01001]
    711979 (RPS6KB1)
Enzymes [BR:mcc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     711979 (RPS6KB1)
Protein kinases [BR:mcc01001]
 Serine/threonine kinases: AGC group
  RSK family [OT]
   711979 (RPS6KB1)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Pkinase_C Kinase-like Pkinase_fungal APH
Other DBs
NCBI-GeneID: 711979
NCBI-ProteinID: XP_014975468
Ensembl: ENSMMUG00000019305
LinkDB
Position
16
AA seq 532 aa
MRRRRRRDGFYPAPDFRDREAEDMAGVFDIDLDQPEDAGSEDELEEGGQLNESMDHGGVG
PYELGMEHCEKFEISETSVNRGPEKIRPECFELLRVLGKGGYGKVFQVRKVTGANTGKIF
AMKVLKKAMIVRNAKDTAHTKAERNILEEVKHPFIVDLIYAFQTGGKLYLILEYLSGGEL
FMQLEREGIFMEDTACFYLAEISMALGHLHQKGIIYRDLKPENIMLNHQGHVKLTDFGLC
KESIHDGTVTHTFCGTIEYMAPEILMRSGHNRAVDWWSLGALMYDMLTGAPPFTGENRKK
TIDKILKCKLNLPPYLTQEARDLLKKLLKRNAASRLGAGPGDAGEVQAHPFFRHINWEEL
LARKVEPPFKPLLQSEEDVSQFDSKFTRQTPVDSPDDSTLSESANQVFLSTVTVFQGFTY
VAPSVLESVKEKFSFEPKIRSPRRFIGSPRTPVSPVKFSPGDFWGRGASASTANPQTPVE
YPMETSGIEQMDVTMSGEASAPLPIRQPNSGPYKKQAFPMISKRPEHLRMNL
NT seq 1599 nt   +upstreamnt  +downstreamnt
atgaggcgacgaaggaggcgggacggcttttacccagcgccggacttccgagacagggaa
gctgaggacatggcaggagtgtttgacatagacctggaccagccagaggacgcgggctca
gaggatgagctggaggaggggggtcagttaaatgaaagcatggaccatgggggagttgga
ccatatgaacttggcatggaacattgtgagaaatttgaaatctcagaaactagtgtgaac
agagggccagaaaaaatcagaccagaatgttttgagctacttcgggtacttggtaaaggg
ggctatggaaaggtttttcaagtacgaaaagtaacaggagcaaatactgggaaaatattt
gccatgaaggtgcttaaaaaggcaatgatagtaagaaatgctaaagatacagctcataca
aaagcagaacggaatattctggaggaagtaaagcatcccttcatcgtggatttaatttat
gcctttcagactggtggaaaactctacctcatccttgagtatctcagtggaggagaacta
tttatgcagttagaaagagagggaatatttatggaagacactgcctgcttttacttggca
gaaatctccatggctttggggcatttacatcaaaaggggatcatctacagagacctgaag
ccggagaatatcatgcttaatcaccaaggtcatgtgaaactaacagactttggactatgc
aaagaatctattcatgatggaacagtcacacacacattttgtggaacaatagaatacatg
gcccctgaaatcttgatgagaagtggccacaatcgtgctgtggattggtggagtttggga
gcattaatgtatgacatgctgactggagcacccccattcactggggagaacagaaagaaa
acaattgacaaaatcctcaaatgtaaactcaatttgcctccctacctcacgcaagaagcc
agagatctgcttaaaaagctgctgaaaagaaatgctgcttctcgtctgggagctggtcct
ggggacgctggagaagttcaagctcatccattctttagacacattaactgggaagaactt
ctggctcgaaaggtggagcccccctttaaacctctgttgcaatctgaagaggatgtaagt
cagtttgattccaagtttacacgtcagacacctgtcgacagcccagatgactcaactctc
agtgaaagtgccaatcaggtctttctgtccactgttactgtctttcagggttttacatat
gtggctccatctgtacttgaaagtgtaaaagaaaagttttcctttgaaccaaaaatccga
tcacctcgaagatttattggcagcccacgaacacctgtcagcccagtcaaattttctcct
ggggatttctggggaagaggtgcttcggccagcacagcaaatcctcagacacctgtggaa
tacccaatggaaacaagtggcatagagcagatggatgtgacaatgagtggggaagcatcg
gcaccacttccaatacgacagccgaactctgggccatacaaaaaacaagcttttcccatg
atctccaaacggccagagcacctgcgtatgaatctatga

KEGG   Macaca mulatta (rhesus monkey): 721731
Entry
721731            CDS       T01028                                 

Gene name
RPS6KB2
Definition
(RefSeq) ribosomal protein S6 kinase beta-2 isoform X2
  KO
K04688  ribosomal protein S6 kinase beta [EC:2.7.11.1]
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc01521  EGFR tyrosine kinase inhibitor resistance
mcc01522  Endocrine resistance
mcc04012  ErbB signaling pathway
mcc04066  HIF-1 signaling pathway
mcc04140  Autophagy - animal
mcc04150  mTOR signaling pathway
mcc04151  PI3K-Akt signaling pathway
mcc04152  AMPK signaling pathway
mcc04211  Longevity regulating pathway
mcc04213  Longevity regulating pathway - multiple species
mcc04350  TGF-beta signaling pathway
mcc04371  Apelin signaling pathway
mcc04666  Fc gamma R-mediated phagocytosis
mcc04714  Thermogenesis
mcc04910  Insulin signaling pathway
mcc04931  Insulin resistance
mcc05163  Human cytomegalovirus infection
mcc05165  Human papillomavirus infection
mcc05170  Human immunodeficiency virus 1 infection
mcc05200  Pathways in cancer
mcc05205  Proteoglycans in cancer
mcc05210  Colorectal cancer
mcc05212  Pancreatic cancer
mcc05221  Acute myeloid leukemia
mcc05224  Breast cancer
mcc05225  Hepatocellular carcinoma
mcc05226  Gastric cancer
mcc05231  Choline metabolism in cancer
mcc05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    721731 (RPS6KB2)
   04350 TGF-beta signaling pathway
    721731 (RPS6KB2)
   04371 Apelin signaling pathway
    721731 (RPS6KB2)
   04066 HIF-1 signaling pathway
    721731 (RPS6KB2)
   04151 PI3K-Akt signaling pathway
    721731 (RPS6KB2)
   04152 AMPK signaling pathway
    721731 (RPS6KB2)
   04150 mTOR signaling pathway
    721731 (RPS6KB2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    721731 (RPS6KB2)
 09150 Organismal Systems
  09151 Immune system
   04666 Fc gamma R-mediated phagocytosis
    721731 (RPS6KB2)
  09152 Endocrine system
   04910 Insulin signaling pathway
    721731 (RPS6KB2)
  09149 Aging
   04211 Longevity regulating pathway
    721731 (RPS6KB2)
   04213 Longevity regulating pathway - multiple species
    721731 (RPS6KB2)
  09159 Environmental adaptation
   04714 Thermogenesis
    721731 (RPS6KB2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    721731 (RPS6KB2)
   05205 Proteoglycans in cancer
    721731 (RPS6KB2)
   05231 Choline metabolism in cancer
    721731 (RPS6KB2)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    721731 (RPS6KB2)
  09162 Cancer: specific types
   05210 Colorectal cancer
    721731 (RPS6KB2)
   05212 Pancreatic cancer
    721731 (RPS6KB2)
   05225 Hepatocellular carcinoma
    721731 (RPS6KB2)
   05226 Gastric cancer
    721731 (RPS6KB2)
   05221 Acute myeloid leukemia
    721731 (RPS6KB2)
   05224 Breast cancer
    721731 (RPS6KB2)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    721731 (RPS6KB2)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    721731 (RPS6KB2)
   05163 Human cytomegalovirus infection
    721731 (RPS6KB2)
   05165 Human papillomavirus infection
    721731 (RPS6KB2)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    721731 (RPS6KB2)
   01522 Endocrine resistance
    721731 (RPS6KB2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mcc01001]
    721731 (RPS6KB2)
Enzymes [BR:mcc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     721731 (RPS6KB2)
Protein kinases [BR:mcc01001]
 Serine/threonine kinases: AGC group
  RSK family [OT]
   721731 (RPS6KB2)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Pkinase_C Kinase-like Pkinase_fungal Seadorna_VP7 Kdo
Other DBs
NCBI-GeneID: 721731
NCBI-ProteinID: XP_001117937
Ensembl: ENSMMUG00000005483
LinkDB
Position
14
AA seq 512 aa
MMFRSGTVSRCAAGYGPRGPRGGASMAAVFDLDLETEEGSEGEGEGEPELSSADVCPFAE
LRAAGLEPVGHYEEVELTETSVNLCPERIGPHCFELLRVLGKGGYGKVFQVRKVQGTNLG
KIYAMKVLRKAKIVRNAKDTAHTRAERNILESVKHPFIVELAYAFQTGGKLYLILECLSG
GELFTHLEREGIFLEDTACFYLAEITLALGHLHSQGIIYRDLKPENIMLSSQGHIKLTDF
GLCKESIHEGAVTHTFCGTIEYMAPEILVRSGHNRAVDWWSLGALMYDMLTGSPPFTAEN
RKKTMDKIIKGKLALPPYLTPDARDLVKKFLKRNPSQRIGGGPGDAADVQRHPFFRHVNW
DDLLARRVDPPFRPCLQSEEDVSQFDTRFTRQTPVDSPDDTALSESANQAFLGFTYVAPS
VLDSIKEGFSFQPKLRSPRRLNSSPRAPISPLKFSPFEGFRPSPSLPEPMEPPLPPLLPP
PPPLPPSITAPLPIRPPSGTKKSKRGRGRPGR
NT seq 1539 nt   +upstreamnt  +downstreamnt
atgatgtttaggtccgggactgtcagtcggtgcgcggccgggtacgggccgaggggcccg
cggggcggcgcctccatggcggccgtgtttgatttggatttggagacggaggaaggcagc
gagggcgagggcgagggcgagccagagctcagctccgcggacgtgtgtccctttgccgag
ttgagggcagctggcctggagcctgtgggacactatgaagaggtggagctgactgagacc
agcgtgaacctctgcccagagcgcatcgggccccactgctttgagctgctgcgtgtgctg
ggcaaggggggctatggcaaggtgttccaggtgcgaaaggtgcaaggcaccaacttgggc
aaaatatatgccatgaaagtcctaaggaaggccaaaattgtgcgcaacgccaaggacaca
gcacacacacgggctgagcggaacattctggagtctgtgaagcacccctttattgtggaa
ctggcctatgccttccagactggtggcaaactctacctcatccttgagtgcctcagtggt
ggcgagctcttcacgcatctggagcgagagggcatcttcctggaagatacagcctgcttc
tacctggccgagatcacgctggccttgggccatctccactcccagggcatcatctaccgg
gacctcaagcccgagaacatcatgctcagcagccagggccacatcaaactgactgacttt
ggactctgcaaggagtcgatccatgagggcgctgtcactcacaccttctgcggcaccatt
gagtacatggctcctgagattctggtgcgcagtggccacaaccgggctgtggactggtgg
agcctgggggccctgatgtacgacatgctcactggatcgccccccttcactgcagagaac
cggaagaaaaccatggataagatcatcaagggcaagctggcgctgcccccctacctcacc
ccagatgcccgggaccttgtcaaaaagtttctgaaacggaatcccagccagaggattggg
ggtggtccaggggatgctgctgatgtgcagaggcatccctttttccggcacgtgaattgg
gacgaccttctggcccggcgtgtggacccccctttcaggccctgtctgcagtcggaggag
gacgtgagccagtttgatacccgcttcacacggcagacgccggtggacagtcccgatgac
acggccctcagtgagagtgccaaccaggccttcctgggcttcacgtacgtggcgccgtct
gtcctggacagcatcaaggagggcttctccttccagcccaagctgcgctcacctaggcgc
ctcaacagtagcccccgggcccccatcagccccctcaagttctccccctttgaggggttt
cggcccagccccagcctgccggagcccatggagccacctctacctccactcctgccaccg
ccgccgccactgccaccctcaatcaccgcccctctccccatccgtcccccctcagggacc
aagaagtccaagaggggccgtgggcgtccaggacgctag

DBGET integrated database retrieval system