KEGG   Macaca mulatta (rhesus monkey): 711995Help
Entry
711995            CDS       T01028                                 

Gene name
HKDC1
Definition
(RefSeq) hexokinase domain containing 1
  KO
K00844  hexokinase [EC:2.7.1.1]
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc00010  Glycolysis / Gluconeogenesis
mcc00051  Fructose and mannose metabolism
mcc00052  Galactose metabolism
mcc00500  Starch and sucrose metabolism
mcc00520  Amino sugar and nucleotide sugar metabolism
mcc00524  Neomycin, kanamycin and gentamicin biosynthesis
mcc01100  Metabolic pathways
mcc01200  Carbon metabolism
mcc04066  HIF-1 signaling pathway
mcc04910  Insulin signaling pathway
mcc04930  Type II diabetes mellitus
mcc04973  Carbohydrate digestion and absorption
mcc05230  Central carbon metabolism in cancer
Module
mcc_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
mcc_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:mcc00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    711995 (HKDC1)
   00051 Fructose and mannose metabolism
    711995 (HKDC1)
   00052 Galactose metabolism
    711995 (HKDC1)
   00500 Starch and sucrose metabolism
    711995 (HKDC1)
   00520 Amino sugar and nucleotide sugar metabolism
    711995 (HKDC1)
  Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    711995 (HKDC1)
 Environmental Information Processing
  Signal transduction
   04066 HIF-1 signaling pathway
    711995 (HKDC1)
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    711995 (HKDC1)
  Digestive system
   04973 Carbohydrate digestion and absorption
    711995 (HKDC1)
 Human Diseases
  Cancers
   05230 Central carbon metabolism in cancer
    711995 (HKDC1)
  Endocrine and metabolic diseases
   04930 Type II diabetes mellitus
    711995 (HKDC1)
Enzymes [BR:mcc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     711995 (HKDC1)
Membrane trafficking [BR:mcc04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    711995 (HKDC1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hexokinase_2 Hexokinase_1
Motif
Other DBs
NCBI-GeneID: 711995
NCBI-ProteinID: XP_001110556
Ensembl: ENSMMUG00000003849
UniProt: F7HAC6
LinkDB All DBs
Position
9
AA seq 917 aa AA seqDB search
MFAVHLMAFYFSKLKEDQIKKVDRFLYHMRLSDDTLLDIMRRFRAEMEKGLAKDTNPTAA
VKMLPTFVRAIPDGSENGEFLSLDLGGSKFRVLKVQVAEEGKRHVQMESQFYPTPNEIIR
GNGTELFEYVADCLADFMKTKDLKHKKLPLGLTFSFPCRQTKLEEGVLLSWTKKFKARGV
QDTDVVSRLTKAMRRHKDMDVDILAVVNDTVGTMMTCAYDDPYCEVGVIIGTGTNACYME
DMSNIDLVEGDEGRMCINTEWGAFGDDGALEDIRTEFDRELDLGSLNPGKQMFEKMISGL
YLGELVRLILLKMAKAGLLFGGEKSSALHTKGKIETRHVAAMEKYKEGLANTREILVDLG
LEPSEADCIAVQHVCTIVSFRSANLCAAALAAILTRLRENKKVERLRTTVGVDGTLYKIH
PQYPKRLHKVVRKLVPSCDVRFLLSESGSTKGAAMVTAVASRVQAQRKQIDKVLALFRLT
REQLVDVQAKMRAELEYGLKKKSHGLATVRMLPTYVCGLPDGTEKGKFLALDLGGTNFRV
LLVKIRSGRRSVRMYNKIFAIPLGIMQGTGEELFDHIVQCIADFLDYMGLKGASLPLGFT
FSFPCRQMSIDKGTLIGWTKGFKATDCEGEDVVDMLREAIKRRNEFDLDIVAVVNDTVGT
MMTCGYEDPNCEIGLIAGTGSNMCYMEDMRNIEMVEGDEGKMCINTEWGGFGDNGCIDDI
RTRYDTEVDEGSLNPGKQRYEKMTSGMYLGEIVRQILIDLTKQGLLFRGQISERLRTRGI
FETKFLSQIESDRLALLQVRTILQQLGLDSTCEDSIVVKEVCGAVSRRAAQLCGAGLAAI
VEKRREDQGLEHLRITVGVDGTLYKLHPHFSRILQETVKELAPRCDVTFMLSEDGSGKGA
ALITAVAKRLQQAQKEN
NT seq 2754 nt NT seq  +upstreamnt  +downstreamnt
atgtttgcggtccacttgatggcattttacttcagcaagctgaaggaggatcagatcaag
aaggtggacaggttcctgtatcacatgcggctctccgatgatacccttttggacatcatg
aggcggttccgagcagagatggagaagggcttggcgaaggacacgaaccccacggccgcg
gtgaagatgctgcccaccttcgtcagggccattcctgatggttccgaaaatggggagttc
ctttccctggatctcggagggtccaagtttcgagtgctgaaggtgcaagtcgctgaagaa
gggaagcgacatgtgcagatggagagtcagttctacccaacacccaatgaaatcatccgt
gggaacggcacagagctgtttgaatatgtagcagactgtctggcagatttcatgaagacc
aaagatttaaagcataagaaattgccccttggcctaactttttctttcccctgccgacag
actaaactggaagagggtgtcctgctttcatggacaaagaagtttaaggcacgaggagtt
caggacacggatgtggtgagccgtctgaccaaagccatgaggagacacaaggacatggac
gtggacatcctggccgtggtcaatgacaccgtggggaccatgatgacctgtgcctatgac
gacccctactgcgaagttggtgtcatcatcggaacaggcacaaatgcgtgttacatggag
gacatgagcaacattgacctggtggagggcgacgagggcaggatgtgcatcaacacagag
tggggggccttcggggacgatggggccctggaggacattcgcaccgagttcgacagggag
ctggacctcggctctctcaacccgggaaagcaaatgtttgagaagatgatcagtggcctg
tacctgggggagcttgtcaggcttatcttgctgaagatggccaaggctggcctcctgttc
ggcggtgagaaatcttctgctctccacactaagggcaagattgaaacacggcacgtggct
gccatggagaagtataaagaaggccttgccaatacaagagagatcctggtggacctgggc
ctggagccatctgaggctgactgcattgccgtccagcatgtctgtaccatcgtctccttc
cgctcagccaacctctgtgcagcagccctggcagccatcctgacacgcctccgggagaac
aagaaggtggaacggctccggaccacggtgggcgtggacggcaccctctacaagatccac
cctcagtacccaaaacgcctgcacaaggtggtgaggaaactggtcccgagctgtgatgtc
cgattcctcctgtcagagagtggcagcaccaagggggccgccatggtgactgcggtggcc
tcccgcgtgcaggcccagcggaagcagatcgacaaggtgctggctttgttccggctgacc
cgagagcagcttgtggacgtgcaggccaagatgcgggctgagctggagtatgggctgaag
aagaagagccacgggctggccacggtcagaatgctgcccacttacgtctgcgggctgccg
gacggcacagagaaaggaaagtttcttgccctggatcttgggggaaccaacttccgggtc
ctcctggtgaagatcagaagtggacggaggtcagtgcgaatgtacaacaagatcttcgcc
atccccctggggatcatgcagggcactggtgaggagctctttgaccacattgtgcagtgc
attgccgacttcctggactacatgggcctcaagggggcctccctacctttgggcttcacg
ttctcatttccctgcaggcagatgagcattgacaagggaacactcatagggtggaccaaa
ggtttcaaggccactgactgtgaaggggaggacgtggtggacatgctcagggaagccatc
aagaggagaaacgagtttgacctggacatcgttgcagttgtgaatgatacagtggggacc
atgatgacctgtggctatgaagatcctaactgtgagattggcttgattgcaggaacaggc
agcaacatgtgctacatggaggacatgaggaacatcgagatggtggagggggacgaaggg
aagatgtgcatcaacacagagtggggaggatttggagacaatggctgcatagatgacatc
cggacccgatacgacacggaggtggacgaggggtccttgaatcctggcaagcagagatac
gagaaaatgaccagtgggatgtacttgggggagattgtgcggcagatcctgatcgacctg
accaagcagggtctcctcttccgagggcagatttcagagcgtctccggaccaggggcatc
ttcgaaaccaagttcctgtcccagattgaaagcgatcggctggccctcctccaggtcagg
acgattctgcagcagctgggcctggacagcacatgtgaggacagcatcgtggtgaaggag
gtgtgcggagctgtgtcccggagggcggcccagctctgcggtgctggcctggccgctata
gtggaaaaaaggagagaagaccaggggctggagcacctgaggatcactgtgggtgtggat
ggcaccctgtacaagctgcaccctcacttttctagaatattgcaggaaactgtgaaggaa
ctagcccctcgatgtgatgtgacattcatgctgtcagaagatggcagtggaaaaggggca
gcactgatcactgctgtggccaagaggttacagcaggcacagaaggagaactag

DBGET integrated database retrieval system