KEGG   Macaca mulatta (rhesus monkey): 712054Help
Entry
712054            CDS       T01028                                 

Gene name
GAA
Definition
(RefSeq) glucosidase alpha, acid
  KO
K12316  lysosomal alpha-glucosidase [EC:3.2.1.20]
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc00052  Galactose metabolism
mcc00500  Starch and sucrose metabolism
mcc01100  Metabolic pathways
mcc04142  Lysosome
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    712054 (GAA)
   00500 Starch and sucrose metabolism
    712054 (GAA)
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    712054 (GAA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mcc04147]
    712054 (GAA)
Enzymes [BR:mcc01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     712054 (GAA)
Exosome [BR:mcc04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   712054 (GAA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Trefoil Gal_mutarotas_2 DUF5110
Motif
Other DBs
NCBI-GeneID: 712054
NCBI-ProteinID: XP_014975985
Ensembl: ENSMMUG00000009589
UniProt: F7AD90
LinkDB All DBs
Position
16
AA seq 952 aa AA seqDB search
MGVRHPLCSRRLLAVCALVSLATAALLGHILLHDFLLVPRELSGSSSVLEETRPARQQGA
SRPGPQNAQAHPGCPRAVPTQCDVPPNSRFDCAPDKAITQEQCEARGCCYIPAKQELRRA
QMGQPWCFFPPSYPSYKLENLSASEMGYTATLTRTTPTFFPKDILTLWLDVMMETENRLH
FTIKDPANKRYEVPLETPRVPSRALSPLYSVEFSEEPFGVIVRRQLDGRVLLNTTVAPLF
FADQFLQLSTSLPSQYITGLAEHLSPLMLSTSWTRITLWNRDLAPTPGANLYGSHPFYLA
LEDGGSAHGVFLLNSNAMDVVLQPSPALSWRSTGGILDVYIFLGPEPKSVVRQYLDVVGY
PFMPPYWGLGFHLCRWGYSSTAITRQVVENMTRAHFPLDVQWNDLDYMDSRRDFTFNKDG
FRDFPAMVQELHQGGRRYVMIVDPAISISGPAGSYRPYDEGLRRGVFITNETGQPLIGKV
WPGSTAFPDFTNPAALAWWEDMVAEFHDQVPFDGMWIDMNEPSNFIRGSEDGCPHNELEE
PPYVPGVVGGTLQAATICASSHQFLSTHYNLHNLYGLTEAIASYRALVKARGTRPFVISR
STFAGHGRYAGHWTGDVWSSWEQLAASVPEILQFNLLGVPLVGADVCGFLGNTSEELCVR
WTQLGAFYPFMRNHNGLLNLPQEPYSFSEPAQQAMRKALTLRYALLPHLYTLFHQAHVAG
ETVARPLFLEFPEDSSTWTVDHQLLWGEALLITPVLQAGKAEVTGYFPSGTWYDLETVPI
EALGSLPPPPAAPREPAIHSEGQWVTLPAPLDTINVHLRAGHIIPLQGPGLTTTESRQQP
MALAVALTKGGEAQGELFWDDGESLEVLERGAYTQVIFLARSNTVMNELVHVTSEGAGLQ
LQKVTVLGVATAPQQVLSNGAPVSNFTYSPDTKVLDIPVSLLVGEQFLISWS
NT seq 2859 nt NT seq  +upstreamnt  +downstreamnt
atgggagtgaggcacccgctctgctcccgccggctgctggccgtctgtgcccttgtgtcc
ttggccaccgctgcgctcctgggacacatcctgctccatgatttcctgctggttccccga
gagctgagtggatcctcctcggtcctggaggagactcgcccagctcgccagcagggagcc
agcaggccagggccccagaatgcccaggcacaccccggctgtcccagagcagtgcccaca
cagtgcgacgtcccccctaacagccgcttcgattgtgcccctgacaaggccatcacccag
gaacagtgcgaggcccgcggctgctgctacatccctgcaaagcaggaacttcggagagcc
cagatgggacagccctggtgcttcttcccacccagctaccccagctacaagctggagaac
ctgagtgcctctgaaatgggctacacggccaccctgacccgtaccacccccaccttcttc
cccaaggacatcctgaccttgtggctggacgtgatgatggagactgagaaccgcctccac
ttcacaatcaaagatcccgctaacaagcgctacgaggtgcccttggagaccccgcgtgtc
cccagccgggcactgtccccactctacagcgtggagttctccgaggagcccttcggggtg
attgtgcgccggcagctggacggtcgtgtgctgctgaacacgacggtggcgcccctgttc
tttgcggaccagttccttcagttgtccacctcgctgccctcgcagtacatcacaggactc
gccgagcacctcagtcccctgatgctcagcaccagctggaccaggatcaccctgtggaac
cgggacctcgcgcccacgcccggtgcgaacctctacgggtctcaccctttctacctggcg
ctggaggatggcgggtcggcacatggggtgttcctgctgaacagcaatgccatggatgtg
gtcctgcagccgagccctgcccttagctggaggtcgacaggtgggatcctggatgtgtac
atcttcctgggcccggagcccaagagcgtggtgcggcagtacctggatgttgtgggatac
ccgttcatgccgccatactggggcctgggcttccacctgtgccgctggggctactcctcc
accgccatcacccgccaggtggtggagaacatgaccagggcccacttccccctggacgtc
cagtggaacgacttggactacatggactcccggagggacttcacgttcaacaaggatggc
ttccgggacttcccagccatggtgcaggagctgcaccagggcggccggcgctacgtgatg
attgtggatcctgccatcagcatctcgggccctgccgggagctacagaccctacgacgag
ggtctgcggaggggggttttcatcaccaacgagaccggccagccgctgatcgggaaggtg
tggcctgggtccactgccttccccgacttcaccaaccccgcagccctggcctggtgggag
gacatggtggctgagttccatgaccaggtgcccttcgacggcatgtggattgacatgaac
gagccttccaacttcatcaggggctctgaggacggctgcccccacaatgagctggaggag
ccaccctacgtgcctggggtggttggggggaccctccaggcggccaccatctgtgcctcc
agccaccagttcctctctacacactacaacctgcacaacctctacggcctgactgaagcc
atcgcctcctacagggcactggtgaaggctcgggggacacgcccatttgtgatctcccgc
tcgacctttgctggccacggccgatatgccggccactggacgggggacgtgtggagctcc
tgggagcagctcgccgcctccgtgccagaaatcctgcagtttaacctgctgggggtgcct
ctggtcggggccgacgtctgcggcttcctgggcaacacctcagaggagctgtgtgtgcgc
tggacccagctgggggccttctacccctttatgcggaaccacaacggcctgctcaatctg
ccccaggagccatacagtttcagcgagccagcccagcaggccatgaggaaggccctcacc
ctgcgctacgcactcctcccccacctctacacgctgttccaccaggcccacgtcgctggg
gagaccgtggcccggcctctcttcctggagttccccgaggactctagcacctggactgtg
gaccaccagctcctgtggggggaggccctgctcatcaccccagtgctgcaggccgggaag
gccgaagtgactggctacttcccctcaggcacatggtacgacctggagacggtgccaata
gaggcccttggcagcctcccgcccccacctgcagctccccgtgagccagccatccacagc
gaggggcagtgggtgacgctgccagcccccctggacaccatcaatgtccacctccgggct
gggcacatcatccccctgcagggccctggcctcacaaccacagagtcccgccagcagccc
atggccctggctgtggccctgaccaagggtggggaggcccaaggggagctgttctgggac
gatggagagagcctggaagtgctggagcgaggggcctacacacaggtcatattcctggcc
aggagtaacacggtcatgaatgagctggtacatgtgaccagcgagggggctggcctgcag
ctgcagaaggtgaccgtcctgggcgtggccacagcgccccagcaggtcctctccaacggc
gcccctgtctccaacttcacctacagccccgacaccaaggtcctggacatccctgtctcg
ttgttggtgggagagcagtttctcatcagctggtcttag

DBGET integrated database retrieval system