KEGG   Macaca mulatta (rhesus monkey): 712588
Entry
712588            CDS       T01028                                 

Gene name
TRIM25
Definition
(RefSeq) E3 ubiquitin/ISG15 ligase TRIM25
  KO
K10652  tripartite motif-containing protein 25 [EC:2.3.2.27]
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04064  NF-kappa B signaling pathway
mcc04622  RIG-I-like receptor signaling pathway
mcc05164  Influenza A
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    712588 (TRIM25)
 09150 Organismal Systems
  09151 Immune system
   04622 RIG-I-like receptor signaling pathway
    712588 (TRIM25)
 09160 Human Diseases
  09172 Infectious disease: viral
   05164 Influenza A
    712588 (TRIM25)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:mcc04121]
    712588 (TRIM25)
Enzymes [BR:mcc01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     712588 (TRIM25)
Ubiquitin system [BR:mcc04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   TRIM/RBCC proteins
    712588 (TRIM25)
SSDB
Motif
Pfam: SPRY PRY zf-RING_UBOX zf-C3HC4_4 zf-C3HC4 zf-RING_2 zf-C3HC4_2 zf-C3HC4_3 zf-RING_5 Prok-RING_4 zf-B_box zf-RING_11 Pox_Rif Filament Exonuc_VII_L
Other DBs
NCBI-GeneID: 712588
NCBI-ProteinID: XP_014974667
Ensembl: ENSMMUG00000005790
UniProt: F6VU89
LinkDB
Position
16
AA seq 630 aa
MAQLCPLAEELSCSICLEPFKEPVTTPCGHNFCGSCLNETWAVQGAPYLCPQCRAVYQAR
PQLHKNTVLCNVVEQFLQAELAREPPADGWTPPARASAPSPGAQVACDHCLKEAAVKTCL
VCMASFCQEHLQPHFDSPAFQDHPLQSPVRDLLRRKCSQHNRLREFFCPEHGECICHICL
VEHKACSPASLSQASANLEATLRHKLTVMYSQINGASRALDDVRNRQQDVRMTANRKVEQ
LRQEYTEMKALLDASETTSTRKIKEEEKRVNTKFDTIYQILLKKKSEIQTLKEEIEQGLT
EGDEFEFLEKASKLRGISTKPVYIPEVELNRKLIKGIYHSTLDLKNELKQCIRQLQEPTP
SSGDPGEHDPASTQKSTRPAKKVSKEEKKSKKPPSVPASSSKLPTFGAPEQLVDLKQPGS
EAAAKATSSHPNSASLKAKVLETFLAKSRPELLEYYVKVILDYNTAHNKVALSESYTVAS
VAEMPQNYRPHPQRFTYCSQVLGLHCYKKGIHYWEVELQKNNFCGVGICYGSMNRQGPES
RLGRNSASWCVEWFNTKISAWHNNVEKTLPSTKATRVGVLLNCDHGFVIFFAVADRVHLM
YKFKVDFTEALYPAFWVFSAGATLSICSPK
NT seq 1893 nt   +upstreamnt  +downstreamnt
atggcacagctgtgccccctggccgaggagctgtcgtgctccatctgcctggagcccttc
aaggagccggtcaccactccgtgcggccacaacttctgcggttcgtgcctgaacgagacg
tgggccgtccagggcgccccatacttgtgcccgcagtgccgcgccgtttaccaggcgcga
ccgcagctgcacaagaacactgtgctgtgcaacgtggtggagcagttcctgcaggccgag
ctggcccgggagccacccgccgacggctggacgccgcccgcccgcgcctctgcacccagc
ccgggtgcccaggtggcttgcgaccactgcctgaaggaggccgccgtgaagacatgcttg
gtgtgcatggcctccttctgtcaggagcacctgcagccgcacttcgacagccccgccttc
caggaccatccgctgcagtctcccgttcgcgacctgttgcgccgcaaatgttcccagcac
aaccggctgcgagagtttttctgccccgagcacggcgagtgcatctgccacatctgcctg
gtagagcataaggcctgctctcccgcgtccctgagccaggccagcgccaacctggaggcc
accctaaggcacaaactaactgtcatgtacagtcagatcaacggggcgtcgagagcgctg
gatgatgtgaggaacaggcagcaggatgtgcggatgactgcaaacagaaaggtggagcag
ctacgacaagaatacacggaaatgaaggctctcttggacgcctcagagaccacctcgaca
aggaagataaaggaagaggagaagagggtcaacaccaagtttgacaccatttatcagatt
ctcctcaagaagaagagtgagatccagaccctgaaggaggagattgaacagggcctgacc
gagggggatgagttcgagtttctggagaaagcatcaaaactgcgaggaatctcaacaaag
ccagtctacatccccgaggtggaactgaaccgcaagctgataaaaggcatctaccatagc
accttagacctcaaaaacgagctgaagcagtgcatcaggcagctccaggagcccaccccc
agctcaggtgaccctggagagcatgacccagcgtccacacagaaatccacacgccctgcg
aagaaggtctccaaagaggaaaagaaatccaagaaacctccctctgtccctgcctcatcc
agcaagcttcccacatttggagccccggaacagttagtggatttaaaacaacctggctcg
gaggctgcagccaaagccaccagctcgcatccgaactcagcatctctcaaggccaaggtg
ctggagaccttcctggccaagtccagacccgagctcctggagtattacgttaaagtcatc
ctggactacaacaccgcccacaacaaagtggctctgtcagaatcctatacagtagcttct
gtggctgagatgcctcagaactaccggccgcatccccagaggttcacatactgctctcag
gtgctgggtctgcactgctacaagaaggggatccactactgggaggtggagctgcagaag
aacaacttctgtggggtaggcatctgctatggcagcatgaaccggcagggcccagagagc
aggctcggccgcaacagcgcctcctggtgcgtggagtggttcaacaccaagatctctgcc
tggcacaataacgtggagaaaaccctgccctccaccaaggccacgcgggtgggcgtgctt
ctcaactgtgaccacggctttgtcatcttcttcgctgttgccgacagggtccacctgatg
tataagttcaaggtggactttaccgaggctttgtacccggctttctgggtgttttctgct
ggtgccacactctccatctgctcccccaagtag

DBGET integrated database retrieval system