KEGG   Macaca mulatta (rhesus monkey): 712634
Entry
712634            CDS       T01028                                 

Gene name
BRCA1
Definition
(RefSeq) breast cancer type 1 susceptibility protein homolog
  KO
K10605  breast cancer type 1 susceptibility protein [EC:2.3.2.27]
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc01524  Platinum drug resistance
mcc03440  Homologous recombination
mcc03460  Fanconi anemia pathway
mcc04120  Ubiquitin mediated proteolysis
mcc04151  PI3K-Akt signaling pathway
mcc05206  MicroRNAs in cancer
mcc05224  Breast cancer
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    712634 (BRCA1)
  09124 Replication and repair
   03440 Homologous recombination
    712634 (BRCA1)
   03460 Fanconi anemia pathway
    712634 (BRCA1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    712634 (BRCA1)
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    712634 (BRCA1)
  09162 Cancer: specific types
   05224 Breast cancer
    712634 (BRCA1)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    712634 (BRCA1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:mcc01009]
    712634 (BRCA1)
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:mcc04121]
    712634 (BRCA1)
   03036 Chromosome and associated proteins [BR:mcc03036]
    712634 (BRCA1)
   03400 DNA repair and recombination proteins [BR:mcc03400]
    712634 (BRCA1)
Enzymes [BR:mcc01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     712634 (BRCA1)
Protein phosphatases and associated proteins [BR:mcc01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     712634 (BRCA1)
Ubiquitin system [BR:mcc04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   Other single Ring-finger type E3
    712634 (BRCA1)
  Multi subunit Ring-finger type E3
   BRCC complex
    712634 (BRCA1)
Chromosome and associated proteins [BR:mcc03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Centrosome duplication proteins
    Regulators of centriole replication
     712634 (BRCA1)
DNA repair and recombination proteins [BR:mcc03400]
 Eukaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    BRCA1-core complex
     712634 (BRCA1)
    BRCA1-A complex
     712634 (BRCA1)
    BRCA1-B complex
     712634 (BRCA1)
    BRCA1-C complex
     712634 (BRCA1)
    BRCA complex
     712634 (BRCA1)
   FA (Fanconi anemia) pathway
    Downstream FA components
     712634 (BRCA1)
SSDB
Motif
Pfam: BRCT_assoc BRCT zf-C3HC4 zf-C3HC4_2 zf-C3HC4_4 zf-C3HC4_3 zf-RING_UBOX zf-RING_2 zf-RING_5 zf-Nse zf-RING_6 zf-RING_10 zf-ANAPC11 Prok-RING_4 zf-rbx1 zf-RING_4
Other DBs
NCBI-GeneID: 712634
NCBI-ProteinID: NP_001108421
Ensembl: ENSMMUG00000001329
UniProt: Q6J6I9
LinkDB
Position
16
AA seq 1863 aa
MDLSAVRVEEVQNVINAMQKILECPICLELIKEPVSTKCDHIFCRFCMLKLLNQKKGPSQ
CPLCKNDITKRSLQESTRFSQLVEELLKIIHAFQLDTGLQFANSYNFAKKENHSPEHLKD
EVSIIQSMGYRNRAKRLLQSEPENPSLQETSLSVPLSNLGIVRTLRTKQQIQPQKKSVYI
ELGSDSSEDTVNKATYCSVGDQELLQITPQGTRDETSLDSAKKAACEFSEKDITNTEHHQ
SSNNDLNTTEKHATERHPEKYQGSSVSNLHVEPCGTNTHASSLQHENSLLLTKDRMNVEK
AEFCNKSKQPGLARSQHNRWTGSKETCNDRQTPSTEKKVDLNANALYERKEWNKQKLPCS
ENPRDAEDVPWITLNSSIQKVNEWFSRSDELLSSDDSHDGGSESNAKVADVLDVLNEVDE
YSGSSEKIDLLASDPHEPLICKSERVHSSSVESNIKDKIFGKTYRRKANLPNLSHVTENL
IIGALVTESQIMQERPLTNKLKRKRRTTSGLHPEDFIKKADLAVQKTPEIINQGTNQMEQ
NGQVMNITNSAHENKTKGDSIQNEKNPNAIESLEEESAFKTKAEPISSSINNMELELNIH
NSKAPKKNRLRRKSSTRHIHALELVVSRNLSPPNCTELQIDSCSSSEEIKKKNYNQMPVR
HSRNLQLMEDKESATGAKKSNKPNEQTSKRHASDTFPELKLTKVPGSFTNCSNTSELKEF
VNPSLSREEKEEKLETVKVSNNAKDPKDLMLSGERVLQTERSVESSSISLVPDTDYGTQE
SISLLEVSTLGKAKTERNKCMSQCAAFENPKELIHGCSEDTRNDTEGFKYPLGSEVNHSQ
ETSIEIEESELDTQYLQNTFKVSKRQSFALFSNPGNPEEECATFSAHSRSLKKQSPKVTS
ECEQKEENQGKKESNIKPVQTVNITAGFSVVCQKDKPVDNAKCSIKGGSRFCLSSQFRGN
ETGLITPNKHGLLQNPYHIPPLFPVKSFVKTKCNKNLLEENSEEHSVSPERAVGNENIIP
STVSTISHNNIRENAFKEASSSNINEVGSSTNEVGSSINEVGPSDENIQAELGRNRGPKL
NAVLRLGLLQPEVCKQSLPISNCKHPEIKKQEHEELVQTVNTDFSPCLISDNLEQPMGSS
HASEVCSETPDDLLDDGEIKEDTSFAANDIKESSAVFSKSIQRGELSRSPSPFTHTHLAQ
GYQKEAKKLESSEENLSSEDEELPCFQHLLFGKVSNIPSQTTRHSTVATECLSKNTEENL
LSLKNSLTDCSNQVILAKASQEHHLSEETKCSGSLFSSQCSELEDLTANTNTQDPFLIGS
SKRMRHQSESQGVGLSDKELVSDDEERGTGLEEDNQEEQSVDSNLGEAASGYESETSVSE
DCSRLSSQSEILTTQQRDTMQDNLIKLQQEMAELEAVLEQHGSQPSNSYPSIITDSSALE
DLRNPEQSTSEKAVLTSQKSSEYPINQNPEGLSADKFEVSADSSTSKNKEPGVERSSPSK
CQSLEDRWYVHSSSGSLQNGNYPSQEELIKVVDVETQQLEKSGPHDLMEPSYLPRQDLDG
TPYLESGISLFSDDPESDPSEDRAPESAHVGSIPSSTSALKVPQWQVAESAQSPAAAHNT
NTAGYNAMEESVSRENPKLTASTERVNKRMSLVVSGLTPEEFMLVYKFARRYHIALTNLI
SEETTHVVMKTDAEFVCERTLKYFLGIAGGKWVVSYFWVTQSIKERKMLNEHDFEVRGDV
VNGRNHQGPKRARESPDRKIFRGLEICCYGPFTNMPTDQLEWMVQLCGASVVKELSSFTL
GTGFHPIVVVQPDAWTEDNGFHAIGQMCEAPVVTREWVLDSVALYQCQELDTYLIPQIPH
SHY
NT seq 5592 nt   +upstreamnt  +downstreamnt
atggatttatctgctgttcgcgttgaagaagtacaaaatgtcattaatgctatgcagaaa
atcttagagtgtccaatctgtctggagttgatcaaggaacctgtctccacaaagtgtgac
cacatattttgcagattttgcatgctgaaacttctcaaccagaagaaagggccttcacag
tgtcctttgtgtaagaatgatataaccaaaagaagcctacaagaaagtacaagatttagt
caacttgttgaagagctattgaaaatcattcatgcttttcagcttgacacaggtttgcag
tttgcaaacagttataattttgcaaaaaaggaaaatcactctcctgaacatctaaaagat
gaagtttctatcatccaaagtatgggctacagaaaccgtgccaaaagacttctacagagt
gaacccgaaaatccttccttgcaggaaaccagtctcagtgtcccactctctaaccttgga
attgtgagaactctgaggacaaagcagcagatacaacctcaaaagaagtctgtctacatt
gaactgggatctgattcttctgaagatacggttaataaggcaacttattgcagtgtggga
gatcaagaattgttacaaatcacccctcaaggaaccagggatgaaaccagtttggattct
gcaaaaaaggctgcttgtgaattttctgagaaggatataacaaatactgaacatcatcag
tccagtaataatgatttgaacaccactgagaaacatgcaactgagaggcatccagaaaag
tatcagggtagttctgtttcaaacttgcatgtggagccatgtggcacaaatactcatgcc
agctcattacagcatgagaacagtttattactcactaaagacagaatgaatgtagaaaag
gctgaattctgtaataaaagcaaacagcctggcttggcaaggagccaacataacagatgg
actggaagtaaggaaacatgtaatgataggcagactcccagcacagagaaaaaggtagat
ctgaatgctaatgccctgtatgagagaaaagaatggaataagcaaaaactgccatgctct
gagaatcctagagacgctgaagatgttccttggataacactaaatagcagcattcagaaa
gttaatgagtggttttccagaagtgatgaactgttaagttctgatgactcacatgatggg
gggtctgaatcaaatgccaaagtagctgatgtattggacgttctaaatgaggtagatgaa
tattctggttcttcagagaaaatagacttactggccagtgatcctcatgagcctttaata
tgtaaaagtgaaagagttcactccagttcagtagagagtaatattaaagacaaaatattt
gggaaaacctatcggaggaaggcaaaccttcccaatttaagccatgtaactgaaaatcta
attataggagcacttgttactgagtcacagataatgcaagagcgtcccctcacaaataaa
ttaaagcgtaaaaggagaactacatcaggtcttcatcctgaggattttataaagaaagca
gatttggcagttcaaaagactcctgaaataataaatcagggaactaaccaaatggagcag
aatggtcaagtgatgaatattactaatagtgctcatgagaataaaacaaaaggtgattct
attcagaatgagaaaaatcctaacgcaatagaatcactggaagaagaatctgctttcaaa
actaaagctgaacctataagcagcagtataaacaatatggaactagaattaaatatccac
aattcaaaagcacctaaaaaaaataggctgaggaggaagtcttctaccaggcatattcat
gcgcttgaactagtagtcagtagaaatctaagcccacctaattgtactgaactacaaatt
gatagttgttctagcagtgaagagataaagaaaaaaaattacaaccaaatgccagtcagg
cacagcagaaacctacaactcatggaagataaagaatctgcaactggagccaagaagagt
aacaagccaaacgaacagacaagtaaaagacatgccagtgatactttcccagaactgaag
ttaacaaaggtacctggttcttttactaactgttcaaatactagtgaacttaaagaattt
gtcaatcctagcctttcaagagaagaaaaagaagagaaactagaaacagttaaagtgtct
aataatgccaaagaccccaaagatctcatgttaagtggagaaagggttttacaaactgaa
agatctgtagagagtagcagtatttcattggtacctgataccgattatggcactcaggaa
agtatctcattactggaagttagcactctagggaaggcaaaaacagaacgaaataaatgt
atgagtcagtgtgcagcatttgaaaaccccaaggaactaattcatggttgttctgaagat
actagaaatgacacagaaggctttaagtatccattgggaagtgaagttaaccacagtcag
gaaacaagcatagaaatagaagaaagtgaacttgatactcagtatttgcagaatacattc
aaggtttcaaagcgccagtcctttgctctgttttcaaatccaggaaatccagaagaggaa
tgtgcaacattctctgcccactctaggtccttaaagaaacaaagtccaaaagttacttct
gaatgtgaacaaaaggaagaaaatcaaggaaagaaagagtctaatatcaagcctgtacag
acagttaatatcactgcaggcttttctgtggtttgtcagaaagataaaccagttgataat
gccaaatgtagtatcaaaggaggctctaggttttgtctatcatctcagttcagaggcaac
gaaactggactcattactccaaataaacatggacttttacaaaacccataccatatacca
ccactttttcctgtcaagtcatttgttaaaactaaatgtaacaaaaacctgctagaggaa
aactctgaggaacattcagtgtcacctgaaagagcagtgggaaacgagaacatcattcca
agtacagtgagcacaattagccataataacattagagaaaatgcttttaaagaagccagc
tcgagcaatattaatgaagtaggttccagtactaatgaagtgggctccagtattaatgaa
gtaggtcccagtgatgaaaacattcaagcagaactaggtagaaacagagggccaaaattg
aatgctgtgcttagattagggcttttgcaacctgaggtctgtaaacaaagtcttcctata
agtaattgtaagcatcctgaaataaaaaagcaagaacatgaagaattagttcagactgtt
aatacagacttctctccatgtctgatttcagataacctagaacagcctatgggaagtagt
catgcgtctgaggtttgttctgagactcctgatgatctgttagatgatggtgaaataaag
gaagatactagttttgctgcaaatgacattaaggagagttctgctgtttttagcaaaagc
atccagagaggagagctcagcaggagccctagccctttcacccatacacatttagctcag
ggttaccaaaaagaggccaagaaattagagtcctcagaagagaacttatctagtgaggat
gaagagcttccctgcttccaacacttgttatttggtaaagtaagcaatataccttctcag
actactaggcatagcactgttgctaccgagtgtctgtctaagaacacagaggagaattta
ttatcattgaagaatagcttaactgactgtagtaaccaggtaatattggcaaaggcatcc
caggaacatcaccttagtgaggaaacaaaatgttctggtagcttgttttcttcacagtgc
agtgaactggaagacttgactgcaaatacaaacacccaggatcctttcttgattggttct
tccaaacgaatgaggcatcagtctgaaagccagggagttggtctgagtgacaaggaattg
gtttcagatgatgaagaaaggggaacgggcttggaagaagataatcaagaagagcaaagt
gtggattcaaacttaggtgaagcagcatccgggtatgagagtgaaacaagcgtctctgaa
gactgctcaaggctctcctctcagagcgaaattttaaccactcagcagagggataccatg
caagataacctaataaagctccagcaggaaatggctgaactagaagctgtgttagaacag
cacggaagccagccttctaacagctacccttccatcataactgactcttctgcccttgag
gacctgcgaaatccagaacaaagcacatcagaaaaagcagtattaacttcacagaaaagt
agtgagtatcctataaaccagaatccagaaggcctttctgctgacaagttcgaggtatct
gcagatagttctaccagtaaaaataaagaaccaggagtggaaaggtcatccccttctaaa
tgccagtcattagaggataggtggtatgtgcacagtagctctgggagtcttcagaatgga
aattacccatctcaagaggagctcattaaggttgttgatgtggagacacaacaactggaa
aagtctgggccacacgatttgatggaaccatcttacttgccaaggcaagatctagacgga
accccttacctggaatctggaatcagtctcttctctgatgaccctgaatctgatccttcc
gaagacagagccccagagtcagctcatgttggcagcataccatcttcaacctctgcattg
aaagtaccccagtggcaagttgcagaatctgcccagagtccagctgctgctcataatact
aatactgctgggtataatgcaatggaagaaagtgtgagcagggagaatccgaaattgaca
gcttcaacagaaagggtcaacaaaagaatgtccttggtggtgtctggcctgaccccagaa
gaatttatgctcgtgtacaagtttgccagaagataccacatcgctttaactaatctaatt
agtgaagagactactcatgtcgttatgaaaacagatgctgagtttgtgtgtgaacggacg
ctgaaatattttctgggaattgcgggaggaaaatgggtagttagctatttctgggtgacc
cagtctattaaagaaagaaaaatgctgaatgagcatgattttgaagtcagaggagatgtg
gtcaatggaagaaaccaccaaggtccaaagcgagcaagagaatccccagacagaaagatc
ttcagggggctagaaatctgttgttatgggcccttcaccaacatgcccacagatcaactg
gagtggatggtacagctttgtggtgcttctgtggtgaaggagctttcatcattcaccctt
ggcacaggtttccacccaattgtggttgtgcagccagatgcctggacagaggacaatggc
ttccatgcaattgggcagatgtgtgaggcacctgtggtgacccgagagtgggtgttggac
agtgtagcactctaccagtgccaggagctggacacctacctgataccccagatcccccac
agccactactga

DBGET integrated database retrieval system