KEGG   Macaca mulatta (rhesus monkey): 712787
Entry
712787            CDS       T01028                                 

Gene name
PTK2B
Definition
(RefSeq) protein-tyrosine kinase 2-beta isoform X1
  KO
K05871  focal adhesion kinase 2 [EC:2.7.10.2]
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04020  Calcium signaling pathway
mcc04062  Chemokine signaling pathway
mcc04072  Phospholipase D signaling pathway
mcc04650  Natural killer cell mediated cytotoxicity
mcc04670  Leukocyte transendothelial migration
mcc04912  GnRH signaling pathway
mcc05135  Yersinia infection
mcc05161  Hepatitis B
mcc05163  Human cytomegalovirus infection
mcc05170  Human immunodeficiency virus 1 infection
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    712787 (PTK2B)
   04072 Phospholipase D signaling pathway
    712787 (PTK2B)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    712787 (PTK2B)
   04670 Leukocyte transendothelial migration
    712787 (PTK2B)
   04062 Chemokine signaling pathway
    712787 (PTK2B)
  09152 Endocrine system
   04912 GnRH signaling pathway
    712787 (PTK2B)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    712787 (PTK2B)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    712787 (PTK2B)
   05161 Hepatitis B
    712787 (PTK2B)
   05163 Human cytomegalovirus infection
    712787 (PTK2B)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mcc01001]
    712787 (PTK2B)
Enzymes [BR:mcc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.2  non-specific protein-tyrosine kinase
     712787 (PTK2B)
Protein kinases [BR:mcc01001]
 Non-receptor tyrosine kinases
  FAK family
   712787 (PTK2B)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Focal_AT FERM_N_2 Pkinase FERM_M Kinase-like FERM_F2
Other DBs
NCBI-GeneID: 712787
NCBI-ProteinID: XP_015000503
Ensembl: ENSMMUG00000019159
LinkDB
Position
8
AA seq 1018 aa
MSGVSEPLSRVKVGTLRRPEGPAEPMVVVPVDVEKEDVRILKVCFYSNSFNPGKNFKLVK
CTVQTEIREIITSILLSGRIGPNIQLAECYGLRLKHMKSDEIHWLHPQMTVGEVQDKYEC
LHVEAEWRYDLQIRYLPEDFMESLKEDRTTLLYFYQQLRNDYMQRYASKVSEGMALQLGC
LELRRFFKDMPHNALDKKSNFELLEKEVGLDLFFPKQMQENLKPKQFRKMIQQTFQQYAS
LREEECVMKFFNTLAGFANIDQETYRCELIQGWNITVDLVIGPKGIRQLTSQDAKPTCLA
EFKQIRSIRCLPLEEGQAVLQLGIEGAPQALSIKTSSLAEAENMADLIDGYCRLQGEHQG
SLIVHPRKDGEKRNSLPQIPMLNLEARRSHFSESCSIESDIYAEIPDETLRRPGGSQYGI
AREDVVLNRILGEGFFGEVYEGVYTNHKGEKINVAVKTCKKDCTLDNKEKFMSEAVIMKN
LDHPHIVRLIGIIEEEPTWIIMELYPYGELGHYLERNKNSLKVLTLVLYSLQICKAMAYL
ESINCVHRDIAVRNILVASPECVKLGDFGLSRYIEDEDYYKASVTRLPIKWMSPESINFR
RFTTASDVWMFAVCMWEILSFGKQPFFWLENKDVIGVLEKGDRLPKPDLCPPVLYTLMTR
CWDYDPSDRPRFTELVCSLSDIYQMEKDIAMEQERNARYRTPKILEPTAFQEPPPKPSRP
KYRLPPQTNLLAPKLQFQVPEGLCASSPTLTSPMEYPSPVNSLHTPPLHRHNVFKRHSMR
EEDFIRPSSREEAQQLWEAEKIKMRQILDKQQKQMVEDYQWLRQEEKSLDPMVYMNDKSP
LTPEKEVGYMEFTGPPQKPPRLGAQSIQPTANLDRTDDLVYLNVMELVRAVLELKNELCQ
LPPEGYVVVVKNVGLTLRKLIGSVDDLLPSLPSSSRTEIEGTQKLLNKDLAELINKMRLA
QQNAVTSLSEECKRQMLTASHTLAVDAKNLLDAVDQAKMSPDAQRSWGEALFWGSSSQ
NT seq 3057 nt   +upstreamnt  +downstreamnt
atgtctggggtgtccgagcccctgagccgagtaaaggtgggcacattacgccggcctgaa
ggccccgcagagcccatggtggtggtaccagtagatgtggaaaaggaagacgtgcgtatc
ctgaaggtctgcttctatagcaacagcttcaatcctgggaagaacttcaaactggtcaaa
tgcactgtccagacggagatccgggagattatcacctccatcctgctgagcggacggatt
gggcccaacatccagctggctgagtgctatgggctgaggttgaagcacatgaagtccgat
gagatccactggctgcacccgcagatgacggtgggtgaggtgcaggacaagtatgagtgt
ctgcacgtggaagccgagtggaggtatgaccttcaaatccgctacttgccggaagacttc
atggagagcctgaaggaggacaggaccacgctgctttatttttaccaacagctccggaac
gactatatgcagcgctacgccagcaaggtcagcgagggcatggccctgcagctgggctgc
ctggagctcaggcggttcttcaaggatatgccccacaatgcccttgacaagaagtccaac
ttcgagctcctagaaaaggaagtggggctggacttgtttttcccaaagcagatgcaggag
aacttaaagcccaaacagttccggaagatgatccagcagaccttccagcagtacgcctcg
ctcagggaggaggagtgcgtcatgaagttcttcaacactctcgcgggcttcgccaacatc
gaccaggagacctaccgctgtgaactcattcaaggatggaacattactgtggacctggtc
attggccctaaagggatccgccagctgaccagtcaggatgcaaagcccacctgcctggcc
gagttcaagcagatcaggtccatcaggtgcctgccactggaggagggccaggcggtactg
cagctgggcattgaaggtgccccccaggccttgtccatcaaaacctcgtccctggcagag
gctgagaacatggctgacctcatagatggctactgccggctgcagggggagcaccaaggc
tctctcatcgtccatcctaggaaagatggcgagaagcggaacagcctgccccagatcccc
atgctaaacctggaggcccggcggtcccacttctcagagagctgcagcatagagtcagac
atctacgcagagattcccgacgaaaccctgcgaaggcctggaggttcacagtatggcatt
gcccgtgaagatgtggtcctgaatcgtattcttggggaaggcttttttggggaggtctat
gaaggtgtctacacaaatcacaaaggggagaaaatcaacgtagctgtcaagacctgcaag
aaagactgcactctggacaacaaggagaagttcatgagcgaggcagtgatcatgaagaac
ctcgaccacccgcacatcgtgaggctgatcggcatcattgaagaggagcccacctggatc
atcatggaattgtatccctacggggagctgggccactacctggagcggaacaagaattcc
ctgaaggtgctcaccctcgtgctatactcgctgcagatttgcaaagccatggcctacctg
gagagcatcaactgcgtgcacagggacattgctgtccggaacatcctggtggcctcccct
gagtgtgtgaagctgggggactttggtctttcccggtacattgaggatgaggactattac
aaagcctctgtgactcgtctccccatcaaatggatgtccccagagtccattaacttccga
cgcttcacgacagccagtgatgtctggatgtttgccgtgtgcatgtgggagatcctgagc
tttgggaagcagccgttcttctggctggagaacaaggatgtcatcggggtgctggagaaa
ggggaccggctgcccaagcccgacctctgtccaccagtcctttataccctcatgacccgc
tgctgggactacgaccccagtgaccggccccgcttcaccgagctagtgtgcagcctcagt
gacatttatcagatggagaaggacattgccatggagcaagagaggaatgctcgctaccga
acccctaaaatcttggagcccacagccttccaggaacccccacccaagcccagccgacct
aagtacagactccctccgcaaaccaacctcctggctccgaagctgcagttccaggtccct
gagggtctgtgtgccagctctcctacgctcaccagccctatggagtatccatctcccgtt
aactcactgcacaccccacctctccaccggcacaatgtcttcaaacgccacagcatgcgg
gaggaggacttcatccgacccagcagccgagaagaggcccagcagctgtgggaggccgag
aagatcaagatgcgacaaatcctggacaagcagcagaagcagatggtggaggactaccag
tggctcaggcaggaggagaagtccctggaccccatggtttatatgaatgataagtccccg
ttgacgccagagaaggaggtcggctacatggagttcacagggcccccacagaagccccca
aggctgggcgcgcagtccatccagcccacagctaacctggaccggaccgatgacctggtg
tacctcaatgtcatggagctggtgcgggctgtgctggagctcaagaatgagctctgtcag
ctgcctcccgagggctatgtggtagtggtgaagaacgtggggcttaccctgcggaagctc
atcgggagcgtggacgatctcctgccttccttgccgtcgtcttcacggacagagatcgag
ggtacccagaaactgctcaacaaagacctggcagagctcatcaacaagatgcggctggcc
cagcagaacgccgtgacctccctgagtgaggagtgcaagaggcagatgctgacggcttca
cacaccctggccgtggacgccaagaacctgctcgacgctgtggaccaggccaagatgtcc
cctgatgcacagagaagctggggagaagctttgttttgggggtcaagcagccagtga

DBGET integrated database retrieval system