KEGG   Macaca mulatta (rhesus monkey): 712893Help
Entry
712893            CDS       T01028                                 

Gene name
AMY2B, AMY2A
Definition
(RefSeq) amylase, alpha 2B (pancreatic)
  KO
K01176  alpha-amylase [EC:3.2.1.1]
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc00500  Starch and sucrose metabolism
mcc01100  Metabolic pathways
mcc04973  Carbohydrate digestion and absorption
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    712893 (AMY2B)
 09150 Organismal Systems
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    712893 (AMY2B)
Enzymes [BR:mcc01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     712893 (AMY2B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Alpha-amylase_C Alpha-amylase DUF3078
Motif
Other DBs
NCBI-GeneID: 712893
NCBI-ProteinID: NP_001253115
Ensembl: ENSMMUG00000031908
UniProt: F7GYU4
LinkDB All DBs
Position
1
AA seq 511 aa AA seqDB search
MKFFLLLLTIGFCWAQYSPNTQQGRTSIVHLFEWRWADIALECERYLAPKGFGGVQVSPP
NENVAIHNPSRPWWERYQPVSYKLCTRSGNEDEFRNMVTRCNNVGVRIYVDAVINHMCGN
AVSAGTSSTCGSYFNPGSRDFPAVPYSGWDFNDGKCKTSSGDIENYNDATQVRDCRLTGL
LDLALEKDYVRSEIAEYMNKLIDMGVAGFRLDASKHMWPGDIKAILDKLHNLNSNWFPQG
SKPFIYQEVIDLGGEPIKSSEYFGNGRVTEFKYGAKLGTVIRKWNGEKMSYLKNWGEGWG
FVPSDRALVFVDNHDNQRGHGAGGASILTFWDARLYKMAVGFMLAHPYGFTRVMSSYRWP
RNFQNGKDVNDWVGPPNNNGVIKEVTINPDTTCGNDWVCEHRWRQIRNMVAFRNVVDGQP
FTNWYDNGSNQVAFGRGNKGFIVFNNDDWSFSSTLQTGLPAGTYCDVISGDKIDGNCTGI
KIYVSNDGKAQFSISNSAEDPFIAIHVESKL
NT seq 1536 nt NT seq  +upstreamnt  +downstreamnt
atgaagttctttctgttgcttttaaccattgggttctgctgggctcagtattccccaaat
acacaacaaggacggacatctatcgttcatctgtttgaatggcgatgggctgatattgct
cttgaatgtgagcgatatttagctcccaagggatttggaggggttcaggtctctccacca
aatgaaaatgttgcaattcacaacccttcaagaccttggtgggaaagataccaaccagtt
agctataaattatgcacaagatctggaaatgaagatgaatttagaaacatggtgactaga
tgtaacaatgttggggttcgtatttatgtggatgctgtaattaatcatatgtgtggtaat
gctgtgagtgcaggaacaagcagtacttgtggaagttatttcaaccctggaagtagggac
tttccagcagtcccgtattctggatgggattttaatgatggtaaatgtaaaacttcaagt
ggagatatcgagaactataatgatgctactcaggtcagagattgtcgtctgactggtctt
cttgatcttgcgctggagaaggattatgtgcgttccgagattgccgaatatatgaacaag
ctcattgacatgggagttgcagggttcagacttgatgcttccaagcacatgtggcctgga
gacataaaggcaattttggacaaactgcataatctcaacagtaactggtttcctcaagga
agtaaacctttcatttaccaggaggtaattgatctgggtggtgagccaattaaaagcagt
gagtactttggaaatggccgggtgacagaattcaagtatggtgcaaaactcggcacggtt
attcgcaagtggaatggagagaagatgtcttacttaaagaactggggagaaggttggggt
ttcgtgccttctgacagagcacttgtctttgtggataaccatgacaatcaacgaggacat
ggggctggaggagcctctattcttaccttctgggacgccaggctgtataaaatggcagtt
ggatttatgcttgctcatccttatggatttacacgagtaatgtcaagctaccgttggcca
agaaattttcaaaatggaaaagatgttaatgattgggttgggccaccaaataataatgga
gtaattaaagaagttactattaatccagacactacttgtggcaatgactgggtctgtgaa
catcgatggcgccaaataaggaacatggttgctttccgcaatgtagtggatggtcagcct
tttacaaactggtatgataatgggagcaaccaagtggcttttggaagaggaaacaaagga
ttcattgttttcaacaatgatgactggtcattttcttcaactttgcaaactggtcttcct
gctggcacatactgtgatgtcatttctggagataaaattgatggcaattgcacaggcatt
aaaatctacgtttctaatgatggcaaagctcaattttctattagtaactctgctgaagat
ccatttattgcaattcatgttgaatctaaattataa

DBGET integrated database retrieval system