KEGG   Macaca mulatta (rhesus monkey): 712911
Entry
712911            CDS       T01028                                 

Gene name
NF1
Definition
(RefSeq) neurofibromin isoform X1
  KO
K08052  neurofibromin 1
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc01521  EGFR tyrosine kinase inhibitor resistance
mcc04010  MAPK signaling pathway
mcc04014  Ras signaling pathway
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    712911 (NF1)
   04014 Ras signaling pathway
    712911 (NF1)
 09160 Human Diseases
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    712911 (NF1)
SSDB
Motif
Pfam: RasGAP CRAL_TRIO_2 CRAL_TRIO MOR2-PAG1_C MIF4G_like_2
Other DBs
NCBI-GeneID: 712911
NCBI-ProteinID: XP_014974489
Ensembl: ENSMMUG00000008605
LinkDB
Position
16
AA seq 2849 aa
MAAHRPVEWVQAVVSRFDEQLPIKTGQQNTHTKVSTEHNKECLINISKYKFSLVISGLTT
ILKNVNNMRIFGEAAEKNLYLSQLIILDTLEKCLAGQPKDTMRLDETMLVKQLLPEICHF
LHTCREGNQHAAELRNSASGVLFSLSCNNFNAVFSRISTRLQELTVCSEDNVDVHDIELL
QYINVDCAKLKRLLKETAFKFKALKKVAQLAVINSLEKAFWNWVENYPDEFTKLYQIPQT
DMAECAEKLFDLVDGFAESTKRKAAVWPLQIILLILCPEIIQDISKDVVDENNMNKKLFL
DSLRKALAGHGGSRQLTESAAIACVKLCKASTYINWEDNSVIFLLVQSMVVDLKNLLFNP
SKPFSRGSQPADVDLMIDCLVSCFRISPHNNQHFKICLAQNSPSTFHYVLVNSLHRIITN
STFKHGLGTASALDWWPKIDAVYCHSVELRNMFGETLHKAVQGCGAHPAIRMAQTLTFKE
KVTSLKFKEKPTDLETRSYKYLLLSMVKLIHADPKLLLCNPRKQGPETQGSTAELITGLV
QLVPQSHMPEIAQEAMEALLVLHQLDSIDLWNPDAPVETFWEISSQMLFYICKKLTSHQM
LSSTEILKWLREILICRNKFLLKNKQADRSSCHFLLFYGVGCDIPSSGNTSQMSMDHEEL
LRTPGASLRKGKGNSSMDSAAGCSGTPPICRQAQTKLEVALYMFLWNPDTEAVLVAMSCF
RHLCEEADIRCGVDEVSVHNLLPNYNTFMEFASVSNMMSTGRAALQKRVMALLRRIEHPT
AGNTEAWEDTHAKWEQATKLILNYPKAKMEDGQAAESLHKTIVKRRMSHVSGGGSIDLSD
TDSLQEWINMTGFLCALGGVCLQQRSNSGLATYSPPMGPVNERKGSMISVMSSEGNADTP
VSKFMDRLLSLMVCNHEKVGLQIRTNVKDLVGLELSPALYPMLFNKLKNTISKFFDSQGQ
VLLTDTNTQFVEQTIAIMKNLLDNHTEGSSEHLGQASIETMMLNLVRYVRVLGNMVHAIQ
IKTKLCQLVEVMMARRDDLSFCQEMKFRNKMVEYLTDWVMGTSNQAADDDVKCLTRDLDQ
ASMEAVVSLLAGLPLQPEEGDGVELMEAKSQLFLKYFTLFMNLLNDCSEVEDENAQTGGR
KRGMSRRLASLRHCTVLAMSNLLNANVDSGLMHSIGLGYHKDLQTRATFMEVLTKILQQG
TEFDTLAETVLADRFERLVELVTMMGDQGELPIAMALANVVPCSQWDELARVLVTLFDSR
HLLYQLLWNMFSKEVELADSMQTLFRGNSLASKIMTFCFKVYGATYLQKLLDPLLRIVIT
SSDWQHVSFEVDPTRLEPSESLEENQRNLLQMTEKFFHAIISSSSEFPPQLRSVCHCLYQ
ATCHSLLNKATVKEKKENKKSVVSQRFPQNSIGAVGSAMFLRFINPAIVSPYEAGILDKK
PPPRIERGLKLMSKILQSIANHVLFTKEEHMRPFNDFVKTNFDAARRFFLDIASDCPTSD
AVNHSLSFISDGNVLALHRLLWNNQEKIGQYLSSNRDHKAVGRRPFDKMATLLAYLGPPE
HKPVADTHWSSLNLTSSKFEEFMTRHQVHEKEEFKALKTLSIFYQAGTSKAGNPIFYYVA
RRFKTGQINGDLLIYHVLLTLKPYYAKPYEIVVDLTHTGPSNRFKTDFLSKWFVVFPGFA
YDNVSAVYIYNCNSWVREYTKYHERLLTGLKGSKRLVFIDCPGKLAEHIEHEQQKLPAAT
LALEEDLKVFHNALKLAHKDTKVSIKVGSTAVQVTSAERTKVLGQSVFLNDIYYASEIEE
ICLVDENQFTLTIANQGTPLTFMHQECEAIVQSIIHIRTRWELSQPDSIPQHTKIRPKDV
PGTLLNIALLNLGSSDPSLRSAAYNLLCALTCTFNLKIEGQLLETSGLCIPANNTLFIVS
ISKTLAANEPHLTLEFLEECISGFSKSSIELKHLCLEYMTPWLSNLVRFCKHNDDAKRQR
VTAILDKLITMTINEKQMYPSIQAKIWGSLGQITDLLDVVLDSFIKTSATGGLGSIKAEV
MADTAVALASGNVKLVSSKVIGRMCKIIDKTCLSPTPTLEQHLMWDDIAILARYMLMLSF
NNSLDVAAHLPYLFHVVTFLVATGPLSLRASTHGLVINIIHSLCTCSQLHFSEETKQVLR
LSLTEFSLPKFYLLFGISKVKSAAVIAFRSSYRDRSFSPGSYERETFALTSLETVTEALL
EIMEACMRDIPTCKWLDQWTELAQRFAFQYNPSLQPRALVVFGCISKRVSHGQIKQIIRI
LSKALESCLKGPDTYNSQVLIEATVIALTKLQPLLNKDSPLHKALFWVAVAVLQLDEVNL
YSAGTALLEQNLHTLDSLRIFNDKSPEEVFMAIRNPLEWHCKQMDHFVGLNFNSNFNFAL
VGHLLKGYRHPSPAIVARTVRILHTLLTLVNKHRNCDKFEVNTQSVAYLAALLTVSEEVR
SRCSLKHRKSLLLTDVSMENVPMDTYPIHHGDPTYRTLKETQPWSSPKGSEGYLAATYPT
VGQTSPRARKSMSLDMGQPSQANTKKLLGTRKSFDHLISDTKAPKRQEMESGITTPPKMR
RVAETDYEMETQRISSSQQHPHLRKVSVSESNVLLDEEVLTDPKIQALLLTVLATLVKYT
TDEFDQRILYEYLAEASVVFPKVFPVVHNLLDSKINTLLSLCQDPNLLNPIHGIVQSVVY
HEESPPQYQTSYLQSFGFNGLWRFAGPFSKQTQIPDYAELIVKFLDALIDTYLPGIDEET
SEESLLTPTSPYPPALQSQLSITANLNLSNSMTSLATSQHSPGIDKENVELSPTTGHCNS
GRTRHGSASQVQKQRSAGSFKRNSIKKIV
NT seq 8550 nt   +upstreamnt  +downstreamnt
atggccgcgcacaggccggtggaatgggtccaggccgtggtcagccgcttcgacgagcag
cttccaataaaaacaggacagcagaacacacataccaaagtcagtactgagcacaacaag
gaatgtctaatcaatatttccaaatacaagttttctttggttataagcggcctcactact
atcttaaagaatgttaacaatatgagaatatttggagaagctgctgaaaaaaatttatat
ctctctcagttgattattttggatacactggaaaaatgtcttgctgggcaaccaaaggac
acaatgagattagatgaaacgatgctggtcaaacagttgctgccagaaatctgccatttt
cttcacacctgtcgtgaaggaaaccagcatgcagctgaacttcggaattctgcctctggg
gttttattttctctcagctgcaacaacttcaatgcagtctttagtcgcatttctaccagg
ttacaggaattaactgtttgttcagaagacaatgttgatgttcatgatatagaattgtta
cagtatatcaatgtggattgtgcaaaattaaaacgactcctgaaggaaacagcatttaaa
tttaaagccctaaagaaggttgcacagttagcagttataaatagcctggaaaaggcattt
tggaactgggtagaaaattatccagatgaatttacaaaactataccagatcccacagact
gatatggctgaatgtgcagaaaagctgtttgacttggtggatggttttgctgaaagcacc
aaacgtaaagcagcagtttggccactacaaatcattctccttatcttgtgtccagaaata
atccaggatatatccaaggatgtggttgatgaaaacaacatgaataagaagttatttctg
gacagtctacgaaaagctcttgctggccatggaggaagtaggcagctgacagaaagtgct
gcaattgcctgtgtcaaactgtgtaaagcaagtacttacatcaactgggaagataactct
gtcattttcctacttgttcagtccatggtggttgatcttaagaacctgctttttaatcca
agtaagccattctcaagaggcagtcagcctgcagatgtggatctaatgattgactgcctt
gtttcttgctttcgtataagtcctcacaacaaccaacactttaagatctgcctggctcag
aattcaccttctacatttcactatgtgctggtaaattcactccatcgaatcatcaccaat
agcactttcaagcatggacttggcactgcttcggcattggattggtggcctaagattgat
gctgtgtattgtcactcggttgaacttcgaaatatgtttggtgaaacacttcataaagca
gtgcaaggttgtggagcacacccagcaatacgaatggcacagactcttacatttaaagaa
aaagtaacaagccttaaatttaaagaaaaacctacagacctggagacaagaagctataag
tatcttcttttgtccatggtgaaactaattcatgcagatccaaagctcttgctttgtaat
ccaagaaaacaggggcccgaaacccaaggcagtacagcagagttaattacagggctcgtc
caactagtccctcagtcacacatgccagagattgcgcaggaagcaatggaggctctgctg
gttcttcatcagttagatagcattgatttgtggaatcctgatgctcctgtagaaacattt
tgggagattagctcacaaatgcttttttacatctgcaagaaattaactagtcatcaaatg
cttagtagcacagaaattctcaagtggttgcgggaaattttgatctgcaggaataaattt
cttcttaaaaataagcaggcagatagaagttcctgtcactttctccttttttatggggta
ggatgtgatattccttctagtggaaataccagtcaaatgtccatggatcatgaagaatta
ctacgtactcctggagcctctctccggaagggaaaagggaactcctctatggatagtgca
gcaggatgcagcggaacccccccgatttgccgacaagcccagaccaaactagaagtggcc
ctgtacatgtttctgtggaaccctgacactgaagctgttctggttgccatgtcctgtttc
cgccacctctgtgaggaagcagatatccggtgtggggtggatgaagtgtcagtgcataac
ctcttgcccaactataacacattcatggagtttgcctctgtcagcaatatgatgtcaaca
ggaagagcagcacttcagaaaagagtgatggcactgctgaggcgcattgagcatcccact
gcaggaaacactgaggcttgggaagatacacatgcaaaatgggaacaagcaacaaaacta
atccttaactatccaaaagccaaaatggaagatggccaggctgctgaaagccttcacaag
accattgttaagaggcgaatgtcccatgtgagtggaggaggatccatagatttgtctgac
acagactccctacaggaatggatcaacatgactggcttcctttgtgcccttgggggagtg
tgcctccagcagagaagcaattctggcctggcaacctatagcccacccatgggtccagtc
aatgaacgtaagggttccatgatttcagtgatgtcctcagagggaaacgcagatacacct
gtcagcaaatttatggatcggctcttgtccttaatggtgtgtaaccatgagaaagtggga
cttcaaatacggaccaatgttaaggatctggtgggtctagaattgagtcctgctctgtat
ccaatgctatttaacaaattgaagaataccatcagcaagttttttgactcccaaggacag
gttttattgaccgataccaatactcagtttgtagaacaaaccatagctataatgaagaac
ttgctagataatcataccgaaggcagctctgaacatctggggcaagctagcattgaaaca
atgatgttaaatctggtcaggtatgttcgtgtgcttgggaatatggtccatgcaattcaa
ataaaaacgaaactgtgtcagttagttgaagtaatgatggcaaggagagatgacctctca
ttttgccaagagatgaaatttaggaataagatggtagaatacctgacagactgggttatg
ggaacatcaaaccaagcagcggatgatgatgtaaagtgtcttacaagagatttggaccag
gcaagcatggaagcagtagtttcacttctagctggtctccctctgcagcctgaagaagga
gatggtgtggaattgatggaagccaaatcacagttatttcttaaatacttcacattattt
atgaaccttttgaatgactgcagtgaagttgaagatgaaaatgcacaaacaggtggcagg
aaacgtggcatgtctcggaggctggcatcactgaggcactgtacagtccttgcaatgtca
aacttactcaatgccaacgtagacagtggtctcatgcactccataggcttaggttaccac
aaagatctccagacaagagctacatttatggaagttctgacaaaaatccttcaacaaggc
acagaatttgacacacttgcagaaacggtattggctgatcggtttgagagattggtggaa
ctggtcacaatgatgggtgatcaaggagaactccctatagcgatggctctggccaatgtg
gttccttgttctcagtgggatgaactagctcgagttctggttactctgtttgattctcgg
catttactctaccaactgctctggaacatgttttctaaagaagtagaattggcagactcc
atgcagactctcttccgaggcaacagcttggccagtaaaataatgacgttctgtttcaag
gtatatggtgctacctatctacagaaactcctggatcctttattacgaattgtgatcaca
tcctctgattggcaacatgttagctttgaagtggatcctaccagattagaaccatcagag
agccttgaggaaaaccagcggaacctccttcagatgactgaaaagttcttccatgccatc
atcagttcttcctcagaattcccccctcaacttcgaagtgtgtgccactgtttataccag
gcaacttgccactccctactgaataaagctacagtaaaagaaaaaaaggaaaacaaaaaa
tcagtggttagccagcgtttccctcagaacagcatcggtgcagtaggaagtgccatgttc
ctcagatttatcaatcctgccattgtctcaccatatgaagcagggattttagataaaaag
ccaccacctagaatcgaaaggggcttgaagttaatgtcaaagatacttcagagtatcgcc
aatcatgttctcttcacaaaagaagaacatatgcggcctttcaacgattttgtgaaaacc
aactttgatgcagcacgaaggtttttccttgatatagcatctgattgtcctacaagtgat
gcagtaaatcatagtctttccttcatcagtgacggcaatgtgcttgctttacatcgtcta
ctctggaacaatcaggagaaaatcggccagtatctgtccagcaacagggatcataaagct
gttggaagacgaccttttgataagatggcaacacttcttgcgtacctgggtcctccagag
cacaaacctgtggcagatacacactggtccagccttaaccttaccagttcaaagtttgag
gaatttatgactaggcatcaggtacatgaaaaagaagaattcaaggctttgaaaacgtta
agtattttctaccaagctgggacttccaaagctgggaatcctattttttattatgttgca
cggaggttcaaaactggtcaaatcaatggtgatttgctgatataccatgtcttactgact
ttaaagccatattatgcaaagccatatgaaattgtagtggaccttacccataccgggcct
agcaatcgctttaaaacagactttctctctaagtggtttgttgtttttcctggctttgct
tacgacaacgtctccgcagtctatatctataactgtaactcctgggtcagggagtacacc
aagtaccatgagcggctgctgactggcctcaaaggtagcaaaaggcttgttttcatagac
tgtcctgggaaactggctgagcacatagagcatgaacaacagaaactacctgctgccacc
ttggctttagaagaggacctgaaggtattccacaatgctctcaagctagctcacaaagat
accaaagtttctattaaagttggttctactgctgtccaagtaacctcagcagagcgaaca
aaagtcctaggacaatcagtctttttaaatgacatctattatgcttcggaaattgaagaa
atctgcctagtagatgagaaccagttcaccttaaccattgcaaaccagggcacgccgctc
accttcatgcaccaggagtgtgaagccattgtccagtctatcattcatatccggacccgc
tgggagctgtcacagcccgactctatcccacaacacaccaagattcggccaaaagatgtc
cctgggacactgcttaatatcgcattacttaatttaggcagttctgacccgagtttacgg
tcagctgcctataatcttctgtgtgccttaacttgtacctttaatttaaaaatcgagggc
cagttactagagacatcaggtttatgtatccctgccaacaacaccctctttattgtctct
attagtaagacactggcagccaatgagccacacctcacgttagaatttttggaagagtgt
atttctggatttagcaaatctagtattgaattgaaacacctttgtttggaatacatgact
ccatggctgtcaaatctagttcgtttttgcaagcataatgatgatgccaaacgacaaaga
gtcactgctattcttgacaagctgataacaatgaccatcaatgaaaaacagatgtaccca
tctattcaagcaaaaatatggggaagccttgggcagattacagatctgcttgatgttgta
ctagacagtttcatcaaaaccagtgcaacaggtggcttgggatcaataaaagctgaggtg
atggcagatactgctgtagctttggcttctggaaatgtgaaattggtttcaagcaaggtt
attggaaggatgtgcaaaataattgacaagacatgcttatctccaactcctactttagaa
caacatcttatgtgggatgatattgctattttagcacgctacatgctgatgctgtccttc
aacaattcccttgatgtggcagctcatcttccctacctcttccacgttgttactttctta
gtagccacaggtccgctctcccttagagcttccacacatggactagtcattaatatcatt
cactctctgtgtacttgttcacagcttcattttagtgaagagaccaagcaagttttgaga
ctcagtctgacagaattctcattacccaaattttacttgctgtttggcattagcaaagtc
aagtcagctgctgtcattgccttccgttccagttaccgggacaggtcattctctcctggc
tcctatgagagagagacttttgctttgacatccttggaaacagtcacagaagctttattg
gagatcatggaggcatgcatgagagatattccaacgtgcaagtggctggaccagtggaca
gaactagctcaaagatttgcattccagtataatccatccctgcaaccaagagctcttgtt
gtctttgggtgtattagcaaacgagtgtctcatgggcagataaagcagattatccgtatt
cttagcaaggcacttgagagttgcttaaaaggacctgatacttacaacagtcaagttctg
atagaagctacagtaatagcactaaccaaattacagccacttcttaataaggactcacct
ctgcacaaagccctcttttgggtagctgtggctgtgctgcagcttgatgaagtcaacttg
tattcagcaggcacggcacttcttgaacaaaacctgcatactttagatagtctccgtata
ttcaatgacaagagtccagaggaagtatttatggcaatccggaatcctctggagtggcac
tgcaagcaaatggatcattttgttggactcaatttcaactctaactttaactttgcattg
gttggacaccttttaaaagggtacaggcatccttcacctgccattgttgcaagaacagtc
agaattttacatacactactaactctggttaacaaacacaggaattgtgacaaatttgaa
gtgaatacacagagcgtggcctacttagcagctttacttacagtgtctgaagaagttcga
agtcgctgcagcctaaaacatagaaagtcacttcttcttactgatgtttcaatggaaaat
gttcctatggatacatatcccattcatcatggtgatcctacctataggacactaaaggag
actcagccatggtcctctcccaaaggttctgaaggataccttgcagccacctatccaact
gtcggccagaccagtccccgagccaggaaatccatgagcttggacatggggcagccttct
caggccaacactaagaagttgcttggaacaaggaaaagttttgatcacttgatatcagac
acaaaggctcctaaaaggcaagaaatggaatcagggatcacaacaccccccaaaatgagg
agagtagcagaaactgattatgaaatggaaactcagaggatttcctcatcacaacagcat
ccacatttacgtaaggtttcggtgtctgaatcaaatgttctcttggatgaagaagtactt
actgatccaaaaatccaggcgctgcttcttactgttctagctacactggtaaaatatacc
acagatgagtttgatcaacgaattctttatgaatacttagcagaggccagtgttgtgttt
cccaaagtatttcctgttgtgcataatttgttggactctaagatcaacaccctgttatca
ctgtgccaagatccaaatctgttaaatccaatccatggaattgtgcagagtgtggtgtac
catgaagaatccccaccacaataccaaacatcttacctgcaaagttttggttttaatggc
ttgtggcggtttgcaggacccttttcaaagcaaacacaaattccagactatgctgagctt
attgttaagtttcttgatgccttgattgacacgtacctgcctggaattgatgaagaaacc
agtgaggaatccctcctgacacccacatctccttaccctcctgcactgcagagccagctt
agtatcactgccaaccttaacctctctaattccatgacctcacttgcaacttcccagcat
tccccaggaatcgacaaggagaacgttgaactctcccctaccactggccactgtaacagt
ggacgaactcgccacggatccgcaagccaagtgcagaagcaaagaagcgctggcagtttc
aaacgtaatagcattaagaagatcgtgtga

DBGET integrated database retrieval system