KEGG   Macaca mulatta (rhesus monkey): 712941
Entry
712941            CDS       T01028                                 

Gene name
GFAP
Definition
(RefSeq) glial fibrillary acidic protein isoform X2
  KO
K05640  glial fibrillary acidic protein
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    712941 (GFAP)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mcc04131]
    712941 (GFAP)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:mcc04812]
    712941 (GFAP)
Membrane trafficking [BR:mcc04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Other CMA associated proteins
    712941 (GFAP)
Cytoskeleton proteins [BR:mcc04812]
 Eukaryotic cytoskeleton proteins
  Intermediate filaments
   Intermediate filaments
    Type III
     712941 (GFAP)
SSDB
Motif
Pfam: Filament Filament_head Spc7 DUF1664 Topoisom_I_N GAS T6PP_N
Other DBs
NCBI-GeneID: 712941
NCBI-ProteinID: XP_014975378
Ensembl: ENSMMUG00000013115
LinkDB
Position
16
AA seq 502 aa
MQELACPGSSASGHSYLNGVRGALPIAGLRPNPTPSGYARGRCQGQPGIASPAHSFIKPS
HPRSEQSQGRMERRRITSAARRSYVSSGEMMVGGLAPGRRLGPGTRLSLARMPPPLPTRV
DFSLAGALNAGFKETRASERAEMMELNDRFASYIEKVRFLEQQNKALAAELNQLRAKEPT
KLADVYQAELRELRLRLDQLTANSARLEVERDNLAQDLGTVRQKLQDETNLRLEAENNLA
AYRQEADEATLARLDLERKIESLEEEIRFLRKIHEEEVRELQEQLARQQVHVELDVAKPD
LTAALKEIRTQYEAMASSNMHEAEEWYRSKFADLTDAAARNAELLRQAKHEANDYRRQLQ
SLTCDLESLRGTNESLERQMREQEERHAREAASYQEALARLEEEGQSLKDEMARHLQEYQ
ELLNVKLALDIEIATYRKLLEGEENRITIPVQTFSNLQIRETSLDTKSVSEGHLKRNIVV
KTVEMRDGEVIKESKQEHKDVM
NT seq 1509 nt   +upstreamnt  +downstreamnt
atgcaggagctggcgtgcccaggaagctctgcctctgggcacagttacctcaatggggtg
aggggagctctccccatagctgggctgcggcccaaccccaccccctcaggctatgccagg
gggcgttgccaggggcagccgggcatcgccagtccagcccactccttcataaagccctcg
catcccaggagcgagcagagccagggtaggatggagaggagacgcatcacctccgctgct
cgccgctcctacgtctcttcgggggagatgatggtggggggcctggctcctggccgccgt
ctgggtcctggcacccgcctctccctggctcgaatgccccctccactcccgacccgggtg
gacttctccctggccggagcactcaatgctggcttcaaggagacccgggccagtgagcgg
gcagagatgatggagctcaatgaccgctttgccagctacatcgagaaggttcgcttcctg
gaacagcaaaacaaggcgctggctgctgagctgaaccagctgcgggccaaggagcccacc
aagctggccgacgtctaccaggctgagctgcgagagctgcgactgcggctcgatcaactc
accgccaacagtgcccggctggaggtcgagagggacaatctggcacaggacctgggcacc
gtgaggcagaagctccaggatgaaaccaacctgaggctggaagccgagaacaacctggct
gcctatagacaggaagcagatgaagccaccctggcccgtctggatctggagaggaagatt
gagtcactggaggaggagatccggttcttgaggaagatccacgaggaggaggttcgggaa
ctccaggagcagctggcccgacagcaggtccatgtggagctggacgtggccaagccagac
ctcaccgcagccctgaaagagatccgcacgcagtatgaggcaatggcgtccagcaacatg
catgaagctgaggagtggtaccgttccaagtttgcagacctgacagacgctgctgcccgc
aacgcggagctgctccgccaggccaagcacgaggccaacgactaccggcgccagttgcag
tccttgacctgcgacctggagtctctgcgaggcacgaacgagtccctggagaggcagatg
cgcgagcaggaggagcgccacgcgcgggaggcggccagttaccaagaggcgctggcgcgg
ctggaggaagaggggcagagcctcaaggacgagatggcccgccacttgcaggagtaccag
gagctgctcaacgtcaagctggccctggacatcgagatcgccacctacaggaagctgctg
gagggcgaggagaaccggatcaccattcctgtgcagaccttctccaacctgcagatccga
gaaaccagcctggacaccaagtctgtgtcagaaggccacctcaagaggaacatcgtggtg
aagaccgtggagatgcgggatggagaggtcattaaggagtccaagcaggagcacaaggat
gtgatgtga

DBGET integrated database retrieval system