KEGG   Macaca mulatta (rhesus monkey): 713035
Entry
713035            CDS       T01028                                 

Gene name
BCL2L1
Definition
(RefSeq) bcl-2-like protein 1
  KO
K04570  Bcl-2-like 1 (apoptosis regulator Bcl-X)
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc01521  EGFR tyrosine kinase inhibitor resistance
mcc01524  Platinum drug resistance
mcc04014  Ras signaling pathway
mcc04064  NF-kappa B signaling pathway
mcc04115  p53 signaling pathway
mcc04137  Mitophagy - animal
mcc04140  Autophagy - animal
mcc04151  PI3K-Akt signaling pathway
mcc04210  Apoptosis
mcc04215  Apoptosis - multiple species
mcc04621  NOD-like receptor signaling pathway
mcc04630  JAK-STAT signaling pathway
mcc05012  Parkinson disease
mcc05014  Amyotrophic lateral sclerosis
mcc05022  Pathways of neurodegeneration - multiple diseases
mcc05145  Toxoplasmosis
mcc05162  Measles
mcc05166  Human T-cell leukemia virus 1 infection
mcc05168  Herpes simplex virus 1 infection
mcc05170  Human immunodeficiency virus 1 infection
mcc05200  Pathways in cancer
mcc05202  Transcriptional misregulation in cancer
mcc05212  Pancreatic cancer
mcc05220  Chronic myeloid leukemia
mcc05222  Small cell lung cancer
mcc05225  Hepatocellular carcinoma
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    713035 (BCL2L1)
   04630 JAK-STAT signaling pathway
    713035 (BCL2L1)
   04064 NF-kappa B signaling pathway
    713035 (BCL2L1)
   04151 PI3K-Akt signaling pathway
    713035 (BCL2L1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    713035 (BCL2L1)
   04137 Mitophagy - animal
    713035 (BCL2L1)
  09143 Cell growth and death
   04210 Apoptosis
    713035 (BCL2L1)
   04215 Apoptosis - multiple species
    713035 (BCL2L1)
   04115 p53 signaling pathway
    713035 (BCL2L1)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    713035 (BCL2L1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    713035 (BCL2L1)
   05202 Transcriptional misregulation in cancer
    713035 (BCL2L1)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    713035 (BCL2L1)
   05225 Hepatocellular carcinoma
    713035 (BCL2L1)
   05220 Chronic myeloid leukemia
    713035 (BCL2L1)
   05222 Small cell lung cancer
    713035 (BCL2L1)
  09164 Neurodegenerative disease
   05012 Parkinson disease
    713035 (BCL2L1)
   05014 Amyotrophic lateral sclerosis
    713035 (BCL2L1)
   05022 Pathways of neurodegeneration - multiple diseases
    713035 (BCL2L1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    713035 (BCL2L1)
   05170 Human immunodeficiency virus 1 infection
    713035 (BCL2L1)
   05162 Measles
    713035 (BCL2L1)
   05168 Herpes simplex virus 1 infection
    713035 (BCL2L1)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    713035 (BCL2L1)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    713035 (BCL2L1)
   01524 Platinum drug resistance
    713035 (BCL2L1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:mcc01009]
    713035 (BCL2L1)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mcc03036]
    713035 (BCL2L1)
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mcc02000]
    713035 (BCL2L1)
Protein phosphatases and associated proteins [BR:mcc01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     713035 (BCL2L1)
Chromosome and associated proteins [BR:mcc03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Other centriole associated proteins
    713035 (BCL2L1)
Transporters [BR:mcc02000]
 Other transporters
  Pores ion channels [TC:1]
   713035 (BCL2L1)
SSDB
Motif
Pfam: Bcl-2 BH4 Bcl-2_3
Other DBs
NCBI-GeneID: 713035
NCBI-ProteinID: NP_001247646
Ensembl: ENSMMUG00000005985
UniProt: F6UKR4 G7N551
LinkDB
Position
10
AA seq 233 aa
MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEGTESEMETPSAINGNPSWHLV
DSPAVNGATGHSSSLDAREVIPMAAVKQALREAGDEFELRYRRAFSDLTSQLHITPGTAY
QSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQVLVSRIAAWMATYLNDHLEP
WIQENGGWDTFVELYGNNAAAESRKGQERFNRWFLTGMTVAGVVLLGSLFSRK
NT seq 702 nt   +upstreamnt  +downstreamnt
atgtctcagagcaaccgggagctggtggttgactttctctcctacaagctttcccagaaa
ggatacagctggagtcaatttagtgatgtggaagagaacaggactgaggccccagaaggg
actgaatcggagatggagacccccagtgccatcaatggcaacccatcctggcacctggtg
gacagccccgcggtgaatggagccactggccacagcagcagtttggatgcccgggaggtg
atccccatggcagcagtaaagcaagcgctgagggaggcaggcgacgagtttgaactgcgg
taccggcgggcgttcagtgacctgacatcccagctccacatcaccccagggacagcatat
cagagctttgaacaggtagtgaatgaactcttccgggatggggtaaactggggtcgcatt
gtggcctttttctccttcggcggggcactgtgcgtggaaagcgtagacaaggagatgcag
gtattggtgagtcggatcgcagcttggatggccacttacctgaatgaccacctagagcct
tggatccaggagaacggcggctgggacacttttgtggaactctatgggaacaatgcagca
gccgagagccgaaagggccaggagcgcttcaaccgctggttcctgacgggcatgactgtg
gccggcgtggttctgctgggctcactcttcagtcggaaatga

DBGET integrated database retrieval system