Macaca mulatta (rhesus monkey): 713035 Help Entry 713035            CDS       T01028                                  Gene name BCL2L1 Definition (RefSeq) bcl-2-like protein 1   KO K04570   Bcl-2-like 1 (apoptosis regulator Bcl-X) Organism mcc  Macaca mulatta (rhesus monkey) Pathway mcc01521   EGFR tyrosine kinase inhibitor resistance mcc01524   Platinum drug resistance mcc04014   Ras signaling pathway mcc04064   NF-kappa B signaling pathway mcc04115   p53 signaling pathway mcc04137   Mitophagy - animal mcc04140   Autophagy - animal mcc04151   PI3K-Akt signaling pathway mcc04210   Apoptosis mcc04215   Apoptosis - multiple species mcc04621   NOD-like receptor signaling pathway mcc04630   JAK-STAT signaling pathway mcc05012   Parkinson disease mcc05014   Amyotrophic lateral sclerosis mcc05022   Pathways of neurodegeneration - multiple diseases mcc05145   Toxoplasmosis mcc05162   Measles mcc05166   Human T-cell leukemia virus 1 infection mcc05168   Herpes simplex virus 1 infection mcc05170   Human immunodeficiency virus 1 infection mcc05200   Pathways in cancer mcc05202   Transcriptional misregulation in cancer mcc05212   Pancreatic cancer mcc05220   Chronic myeloid leukemia mcc05222   Small cell lung cancer mcc05225   Hepatocellular carcinoma Brite KEGG Orthology (KO) [BR:mcc00001]  09130 Environmental Information Processing   09132 Signal transduction    04014 Ras signaling pathway     713035 (BCL2L1)    04630 JAK-STAT signaling pathway     713035 (BCL2L1)    04064 NF-kappa B signaling pathway     713035 (BCL2L1)    04151 PI3K-Akt signaling pathway     713035 (BCL2L1)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     713035 (BCL2L1)    04137 Mitophagy - animal     713035 (BCL2L1)   09143 Cell growth and death    04210 Apoptosis     713035 (BCL2L1)    04215 Apoptosis - multiple species     713035 (BCL2L1)    04115 p53 signaling pathway     713035 (BCL2L1)  09150 Organismal Systems   09151 Immune system    04621 NOD-like receptor signaling pathway     713035 (BCL2L1)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     713035 (BCL2L1)    05202 Transcriptional misregulation in cancer     713035 (BCL2L1)   09162 Cancer: specific types    05212 Pancreatic cancer     713035 (BCL2L1)    05225 Hepatocellular carcinoma     713035 (BCL2L1)    05220 Chronic myeloid leukemia     713035 (BCL2L1)    05222 Small cell lung cancer     713035 (BCL2L1)   09164 Neurodegenerative disease    05012 Parkinson disease     713035 (BCL2L1)    05014 Amyotrophic lateral sclerosis     713035 (BCL2L1)    05022 Pathways of neurodegeneration - multiple diseases     713035 (BCL2L1)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     713035 (BCL2L1)    05170 Human immunodeficiency virus 1 infection     713035 (BCL2L1)    05162 Measles     713035 (BCL2L1)    05168 Herpes simplex virus 1 infection     713035 (BCL2L1)   09174 Infectious disease: parasitic    05145 Toxoplasmosis     713035 (BCL2L1)   09176 Drug resistance: antineoplastic    01521 EGFR tyrosine kinase inhibitor resistance     713035 (BCL2L1)    01524 Platinum drug resistance     713035 (BCL2L1)  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:mcc01009]     713035 (BCL2L1)   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:mcc03036]     713035 (BCL2L1)   09183 Protein families: signaling and cellular processes    02000 Transporters [BR:mcc02000]     713035 (BCL2L1) Protein phosphatases and associated proteins [BR:mcc01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Protein phosphatase-1     PP1-interacting proteins (PIPs)      713035 (BCL2L1) Chromosome and associated proteins [BR:mcc03036]  Eukaryotic type   Centrosome formation and ciliogenesis proteins    Other centriole associated proteins     713035 (BCL2L1) Transporters [BR:mcc02000]  Other transporters   Pores ion channels [TC:1]    713035 (BCL2L1) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Bcl-2 BH4 Bcl-2_3 Motif Other DBs NCBI-GeneID:  713035 NCBI-ProteinID:  NP_001247646 Ensembl:  ENSMMUG00000005985 UniProt:  F6UKR4 G7N551 LinkDB All DBs Position 10 AA seq 233 aa AA seqDB search MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEGTESEMETPSAINGNPSWHLV DSPAVNGATGHSSSLDAREVIPMAAVKQALREAGDEFELRYRRAFSDLTSQLHITPGTAY QSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQVLVSRIAAWMATYLNDHLEP WIQENGGWDTFVELYGNNAAAESRKGQERFNRWFLTGMTVAGVVLLGSLFSRK NT seq 702 nt NT seq  +upstreamnt  +downstreamnt atgtctcagagcaaccgggagctggtggttgactttctctcctacaagctttcccagaaa ggatacagctggagtcaatttagtgatgtggaagagaacaggactgaggccccagaaggg actgaatcggagatggagacccccagtgccatcaatggcaacccatcctggcacctggtg gacagccccgcggtgaatggagccactggccacagcagcagtttggatgcccgggaggtg atccccatggcagcagtaaagcaagcgctgagggaggcaggcgacgagtttgaactgcgg taccggcgggcgttcagtgacctgacatcccagctccacatcaccccagggacagcatat cagagctttgaacaggtagtgaatgaactcttccgggatggggtaaactggggtcgcatt gtggcctttttctccttcggcggggcactgtgcgtggaaagcgtagacaaggagatgcag gtattggtgagtcggatcgcagcttggatggccacttacctgaatgaccacctagagcct tggatccaggagaacggcggctgggacacttttgtggaactctatgggaacaatgcagca gccgagagccgaaagggccaggagcgcttcaaccgctggttcctgacgggcatgactgtg gccggcgtggttctgctgggctcactcttcagtcggaaatga

DBGET integrated database retrieval system