KEGG   Macaca mulatta (rhesus monkey): 713114
Entry
713114            CDS       T01028                                 

Gene name
GSK3B
Definition
(RefSeq) glycogen synthase kinase-3 beta isoform X1
  KO
K03083  glycogen synthase kinase 3 beta [EC:2.7.11.26]
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc01521  EGFR tyrosine kinase inhibitor resistance
mcc04012  ErbB signaling pathway
mcc04062  Chemokine signaling pathway
mcc04110  Cell cycle
mcc04150  mTOR signaling pathway
mcc04151  PI3K-Akt signaling pathway
mcc04310  Wnt signaling pathway
mcc04340  Hedgehog signaling pathway
mcc04360  Axon guidance
mcc04390  Hippo signaling pathway
mcc04510  Focal adhesion
mcc04550  Signaling pathways regulating pluripotency of stem cells
mcc04657  IL-17 signaling pathway
mcc04660  T cell receptor signaling pathway
mcc04662  B cell receptor signaling pathway
mcc04722  Neurotrophin signaling pathway
mcc04728  Dopaminergic synapse
mcc04910  Insulin signaling pathway
mcc04916  Melanogenesis
mcc04917  Prolactin signaling pathway
mcc04919  Thyroid hormone signaling pathway
mcc04931  Insulin resistance
mcc04932  Non-alcoholic fatty liver disease
mcc04934  Cushing syndrome
mcc04935  Growth hormone synthesis, secretion and action
mcc05010  Alzheimer disease
mcc05020  Prion disease
mcc05022  Pathways of neurodegeneration - multiple diseases
mcc05135  Yersinia infection
mcc05160  Hepatitis C
mcc05162  Measles
mcc05163  Human cytomegalovirus infection
mcc05165  Human papillomavirus infection
mcc05167  Kaposi sarcoma-associated herpesvirus infection
mcc05200  Pathways in cancer
mcc05210  Colorectal cancer
mcc05213  Endometrial cancer
mcc05215  Prostate cancer
mcc05217  Basal cell carcinoma
mcc05224  Breast cancer
mcc05225  Hepatocellular carcinoma
mcc05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    713114 (GSK3B)
   04310 Wnt signaling pathway
    713114 (GSK3B)
   04340 Hedgehog signaling pathway
    713114 (GSK3B)
   04390 Hippo signaling pathway
    713114 (GSK3B)
   04151 PI3K-Akt signaling pathway
    713114 (GSK3B)
   04150 mTOR signaling pathway
    713114 (GSK3B)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    713114 (GSK3B)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    713114 (GSK3B)
   04550 Signaling pathways regulating pluripotency of stem cells
    713114 (GSK3B)
 09150 Organismal Systems
  09151 Immune system
   04660 T cell receptor signaling pathway
    713114 (GSK3B)
   04657 IL-17 signaling pathway
    713114 (GSK3B)
   04662 B cell receptor signaling pathway
    713114 (GSK3B)
   04062 Chemokine signaling pathway
    713114 (GSK3B)
  09152 Endocrine system
   04910 Insulin signaling pathway
    713114 (GSK3B)
   04917 Prolactin signaling pathway
    713114 (GSK3B)
   04935 Growth hormone synthesis, secretion and action
    713114 (GSK3B)
   04919 Thyroid hormone signaling pathway
    713114 (GSK3B)
   04916 Melanogenesis
    713114 (GSK3B)
  09156 Nervous system
   04728 Dopaminergic synapse
    713114 (GSK3B)
   04722 Neurotrophin signaling pathway
    713114 (GSK3B)
  09158 Development and regeneration
   04360 Axon guidance
    713114 (GSK3B)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    713114 (GSK3B)
  09162 Cancer: specific types
   05210 Colorectal cancer
    713114 (GSK3B)
   05225 Hepatocellular carcinoma
    713114 (GSK3B)
   05226 Gastric cancer
    713114 (GSK3B)
   05217 Basal cell carcinoma
    713114 (GSK3B)
   05215 Prostate cancer
    713114 (GSK3B)
   05213 Endometrial cancer
    713114 (GSK3B)
   05224 Breast cancer
    713114 (GSK3B)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    713114 (GSK3B)
   05020 Prion disease
    713114 (GSK3B)
   05022 Pathways of neurodegeneration - multiple diseases
    713114 (GSK3B)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    713114 (GSK3B)
   04931 Insulin resistance
    713114 (GSK3B)
   04934 Cushing syndrome
    713114 (GSK3B)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    713114 (GSK3B)
  09172 Infectious disease: viral
   05160 Hepatitis C
    713114 (GSK3B)
   05162 Measles
    713114 (GSK3B)
   05163 Human cytomegalovirus infection
    713114 (GSK3B)
   05167 Kaposi sarcoma-associated herpesvirus infection
    713114 (GSK3B)
   05165 Human papillomavirus infection
    713114 (GSK3B)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    713114 (GSK3B)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mcc01001]
    713114 (GSK3B)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mcc03036]
    713114 (GSK3B)
Enzymes [BR:mcc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.26  tau-protein kinase
     713114 (GSK3B)
Protein kinases [BR:mcc01001]
 Serine/threonine kinases: CMGC group
  GSK family [OT]
   713114 (GSK3B)
Chromosome and associated proteins [BR:mcc03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    713114 (GSK3B)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kinase-like APH Kdo ABC1
Other DBs
NCBI-GeneID: 713114
NCBI-ProteinID: XP_014985446
Ensembl: ENSMMUG00000001980
UniProt: H9EPM1
LinkDB
Position
2
AA seq 433 aa
MSGRPRTTSFAESCKPVQQPSAFGSMKVSRDKDGSKVTTVVATPGQGPDRPQEVSYTDTK
VIGNGSFGVVYQAKLCDSGELVAIKKVLQDKRFKNRELQIMRKLDHCNIVRLRYFFYSSG
EKKDEVYLNLVLDYVPETVYRVARHYSRAKQTLPVIYVKLYMYQLFRSLAYIHSFGICHR
DIKPQNLLLDPDTAVLKLCDFGSAKQLVRGEPNVSYICSRYYRAPELIFGATDYTSSIDV
WSAGCVLAELLLGQPIFPGDSGVDQLVEIIKVLGTPTREQIREMNPNYTEFKFPQIKAHP
WTKDSSGTGHFTSGVRVFRPRTPPEAIALCSRLLEYTPTARLTPLEACAHSFFDELRDPN
VKLPNGRDTPALFNFTTQELSSNPPLATILIPPHARIQAAASTPTNATAASDANTGDRGQ
TNNAASASASNST
NT seq 1302 nt   +upstreamnt  +downstreamnt
atgtcagggcggcccagaaccacctcctttgcggagagctgcaagccggtgcagcagcct
tcagcttttggcagcatgaaagttagcagagacaaggatggcagcaaggtgaccacagtg
gtagcaactcctgggcagggtccagacaggccacaagaagtcagctatacagacactaaa
gtgattggaaatggatcatttggtgtggtgtatcaagccaaactttgtgattcaggagaa
ctggtcgccatcaagaaagtattgcaggacaagagatttaagaaccgagagctccagatc
atgagaaagctagatcactgtaacatagtccgattgcgttatttcttctactccagtggt
gagaagaaagatgaggtctatcttaatctggtgctggactatgttccggaaacagtatac
agagttgccagacactatagtcgagccaaacagacgctccctgtgatttatgtcaagtta
tatatgtatcagctgttccgaagtttagcctatatccattcctttggaatctgccatcgg
gatattaaaccacagaacctcttgttggatcctgatacagccgtattaaaactctgtgac
tttggaagtgcaaagcagctggtccgaggagaacccaatgtttcgtatatctgttctcgg
tactatagggcaccagagttgatctttggagccactgattatacctctagtatagatgta
tggtctgctggctgtgtgttggctgagctgctactaggacaaccaatatttccaggggat
agtggtgtggatcaattggtggaaataatcaaggtcctgggaactccaacaagggagcaa
atcagagaaatgaacccaaactacacagaatttaaattccctcaaattaaggcacatccc
tggactaaggattcgtcaggaacaggacatttcacctcaggagtgcgggtcttccgaccc
cgaactccaccagaggcaattgcactgtgtagccgtctgctggagtatacgccaactgcc
cgactaacacctctggaagcttgtgcacattcattttttgatgaattacgggacccaaat
gtcaaactaccaaatgggcgagacacacctgcactcttcaacttcaccactcaagaactg
tcaagtaatccacctctggctaccatccttattcctcctcatgctcggattcaagcagct
gcttcaacccccacaaatgccacagcagcctcagatgctaatactggagaccgtggacag
accaataatgctgcttccgcatcagcttccaactccacctga

DBGET integrated database retrieval system