KEGG   Macaca mulatta (rhesus monkey): 713211Help
Entry
713211            CDS       T01028                                 

Gene name
EIF3A
Definition
(RefSeq) eukaryotic translation initiation factor 3 subunit A
  KO
K03254  translation initiation factor 3 subunit A
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc03013  RNA transport
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    713211 (EIF3A)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:mcc03012]
    713211 (EIF3A)
Translation factors [BR:mcc03012]
 Eukaryotic type
  Initiation factors
   eIF-3
    713211 (EIF3A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PCI
Motif
Other DBs
NCBI-GeneID: 713211
NCBI-ProteinID: XP_015003779
Ensembl: ENSMMUG00000008994
LinkDB All DBs
Position
9
AA seq 1392 aa AA seqDB search
MPAYFQRPENALKRANEFLEVGKKQPALDVLYDVMKSKKHRTWQKIHEPIMLKYLELCVD
LRKSHLAKEGLYQYKNICQQVNIKSLEDVVRAYLKMAEEKTEAAKEESQQMVLDIEDLDN
IQTPESVLLSAVSGEDTQDRTDRLLLTPWVKFLWESYRQCLDLLRNNSRVERLYHDIAQQ
AFKFCLQYTRKAEFRKLCDNLRMHLSQIQRHHNQSTAINLNNPESQSMHLETRLVQLDSA
ISMELWQEAFKAVEDIHGLFSLSKKPPKPQLMANYYNKVSTVFWKSGNALFHASTLHRLY
HLSREMRKNLTQDEMQRMSTRVLLATLSIPITPERTDIARLLDMDGIIVEKQRRLATLLG
LQAPPTRIGLINDMVRFNVLQYVVPEVKDLYNWLEVEFNPLKLCERVTKVLNWVREQPEK
EPELQQYVPQLQNNTILRLLQQVSQIYQSIEFSRLTSLVPFVDAFQLERAIVDAARHCDL
QVRIDHTSRTLSFGSDLNYATREDAPIGPHLQSMPSEQIRNQLTAMSSVLAKALEVIKPA
HILQEKEEQHQLAVTAYLKNSRKEHQRILARRQTIEERKERLESLNIQREKEELEQREAE
LQKVRKAEEERLRQEAKEREKERILQEHEQIKKKTVRERLEQIKKTELGAKAFKDIDIED
LEELDPDFIMAKQVEQLEKEKKELQERLKNQEKKIDYFERAKRLEEIPLIKSAYEEQRIK
DMDLWEQQEEERITTMQLEREKALEHKNRMSRMLEDRDLFVMRLKAARQSVYEEKLKQFE
ERLAEERHNRLEERKRQRKEERRITYYREKEEEEQRRAEEQMLKEREERERAERAKREEE
LREYQERVKKLEEVERKKRQRELEIEERERRREEERRLGDSSLSRKDSRWGDRDSEGTWR
KGPEADSEWRRGPPEKEWRRGEGRDEDRSHRRDEERPRRLGDDEDRESSLRPDDDRVPRR
GMDDDRGPRRGPEEDRFSRRGADDDRPSWRNTDDDRPPRRIADEDRGSWRHADDDRPPRR
GLDEDRGSWRTADEDRGPRRGMDDDRGPRRGGADEERSSWRNADDDRGPRRGLDDDRGPR
RGLDDDRGPRRGLDDDRGPRRGLDDDRGPRRGMDDDRGPRRGLDDDRGPWRNADEDRIPR
RGAEDDRGPWRNMDDDRLSRRADDDRFPRRGDDSRPGPWRPLVKPGGWREKEKAREESWG
PPRESRPSEEREWDREKERDRDNQDREENDKEPERERERERDVDREDRFRRPRDEGGWRR
GPAEESSSWRDSSRRDDRDRDDRRRERDDRRDLRERRDLRDDRDRRGPPLRSEREEVSSW
RRADDRKDDRAEERDPPRRVPPPALSRDRERDRDREREGEKEKASWRAEKDRESLRRTKN
ETDEDGWTTVRR
NT seq 4179 nt NT seq  +upstreamnt  +downstreamnt
atgccggcctattttcagaggccggaaaatgccctcaaacgcgccaacgaatttcttgag
gttggcaaaaagcagcctgctctggacgttctttatgatgttatgaaaagtaaaaaacat
agaacatggcaaaagatacacgaaccaattatgttgaaatacttggaactttgcgtggat
cttcgcaagagccacttggcaaaggaggggttgtaccagtataagaacatttgtcaacag
gtgaacataaaatctctggaggatgttgttagggcatatttgaaaatggcagaggaaaaa
actgaagctgctaaagaagaatctcagcagatggtcttagatatagaagatctggataat
attcaaactcctgagagtgttctcctaagtgctgtaagtggtgaagacactcaggatcgt
actgacagattacttttaactccatgggttaaattcctgtgggagtcttacaggcagtgt
ttggaccttcttagaaacaattctagagtagagcgcctttatcatgatattgcccagcaa
gctttcaaattctgcctccaatacacgcgtaaggctgaattccgtaaactgtgtgacaat
ttgagaatgcacttatcgcagattcagcgccaccataaccaaagtacggcaatcaatctt
aataatccagagagccagtccatgcatttggaaaccagacttgttcagttggacagtgct
atcagcatggaattgtggcaggaagcattcaaagctgtggaagatattcatgggctattc
tccttgtctaaaaaaccacctaaacctcagttgatggcaaattactataacaaagtctca
actgtgttttggaaatctggaaatgctctttttcatgcatctacactccatcgtctttac
catctctctagagaaatgagaaagaatcttacacaagatgagatgcaaagaatgtctact
agagtccttttagccactctttccatccctattactcctgagcgtacggatattgctcga
cttctggatatggatggcattatagttgaaaaacagcgtcgccttgcaacactactaggt
cttcaagccccaccgacacgaattggccttattaatgatatggtcagatttaatgtacta
caatatgttgtcccagaagtgaaagacctttacaattggcttgaagtggaatttaaccca
ttaaaactctgtgagcgagtcacaaaggttctaaattgggttagggaacaacctgaaaag
gaaccggaattgcaacagtatgtgccacaactgcaaaacaacaccatcctccgccttctg
cagcaggtgtcacagatttatcagagcattgagttttctcgtttgacttctctggttcct
ttcgttgatgctttccaactggaacgggccatagtagacgcagccaggcattgcgacttg
caggttcgtattgatcacacttctcggaccctgagttttggatctgatttgaattatgct
actcgagaagatgctccgattggtcctcatttgcaaagcatgccttccgagcagataaga
aatcagctgacagccatgtcctcagtacttgcaaaagcacttgaagtcattaaaccagct
catatactgcaagagaaagaagaacagcatcagttggctgttactgcataccttaaaaat
tcacgaaaagagcaccagcgaatcctggctcgccgccagacaattgaggaaagaaaagag
cgccttgagagtctgaatattcagcgtgagaaagaagaattggaacagagggaagctgaa
ctccagaaagtacggaaggctgaggaagagaggctgcgccaggaagcgaaggagagagag
aaggagcgtatcttacaggaacatgaacaaatcaaaaagaaaactgttcgagagcgtttg
gagcagatcaagaaaacagaactgggtgccaaggcattcaaagatattgacattgaagac
cttgaggaattggatccagattttatcatggctaaacaggttgaacaactggagaaagaa
aagaaagaacttcaggaacgcctaaagaatcaagaaaagaagattgactattttgaaaga
gccaaacgtttggaagaaattcctttgataaagagcgcttacgaggaacagagaattaaa
gacatggatctgtgggagcaacaagaggaagaaagaattactacaatgcagctagaacgt
gaaaaggctcttgaacataagaatcgaatgtcacgaatgcttgaagacagagatttattt
gtaatgcgactcaaagctgcacggcagtctgtttatgaggaaaaacttaaacagtttgaa
gagcgattagcagaagaaaggcataatcgattggaagaacggaaaaggcaacgtaaagaa
gaacgcagaataacatattatagagaaaaagaagaggaggagcaaagaagggcagaagaa
caaatgctaaaagagcgggaagagagagagcgcgctgaacgagcaaaacgcgaggaagag
ctacgagagtatcaggagcgggtgaagaaattagaagaagtggaaaggaaaaaacgccaa
agggagttggaaattgaagaacgagaacgtcgtagagaggaagagagaagacttggcgat
agttcactttctagaaaggactctcgttggggagatagagattcagaaggcacctggaga
aaaggacctgaagcagattctgagtggagaagaggcccgccagagaaggagtggagacgt
ggagaagggcgagatgaggacaggtctcatagaagagatgaagagcggccccggcgtctg
ggggatgatgaagatagagagtcctctcttagaccagatgatgatcgggttccccggcgt
ggcatggatgatgacagaggccctagacgtggtcctgaggaagatcggttctctcgccgt
ggggcagacgatgaccggccttcttggcgtaacacagatgatgacaggcctcccagacga
attgctgatgaagacaggggaagctggcgtcacgcggatgatgacagaccacctagacga
ggactggatgaggacagaggaagctggcgaacagctgacgaggacagaggaccaagacgt
gggatggatgacgaccgggggccgaggcgaggcggcgctgatgaagagcgatcatcctgg
cgtaatgctgacgatgaccggggtcccaggcgagggttggatgacgaccggggtcccagg
cgagggctggatgacgaccggggtcccaggcgagggctggatgacgaccggggtcccagg
cgagggttggatgacgaccggggtcccaggcgaggcatggatgatgaccggggtcccagg
cgagggttggatgatgatcgaggaccttggagaaatgccgatgaagatagaattcccagg
cgtggtgcagaggatgacaggggcccttggagaaacatggatgatgatcggctttcaaga
cgtgctgatgatgatcgctttcccagacggggtgatgactcaaggcctggtccttggaga
ccattagtcaagccaggtggatggagagagaaagaaaaagccagagaggagagctggggt
ccacctcgagaatcaaggccatcagaagaacgtgaatgggacagagaaaaagaaagagat
agagataatcaagatcgagaggagaatgacaaggaacctgagagagaaagggagagagag
agagatgtggatcgagaggatcgcttcagaagacctagggatgaaggtggctggagaaga
ggaccagctgaggaatcttcaagctggagagactcaagtcgtcgggatgatagagatagg
gatgaccgtcgccgtgagagggatgaccggcgtgatctaagagaaagacgagatctaaga
gacgatagggaccgaagaggacctccgctcagatcagaacgtgaagaagtaagttcttgg
agacgtgctgatgacaggaaagatgaccgggcagaagagcgggaccctcctcgtcgagtt
cctcccccagctctttcaagagaccgagaaagagaccgagaccgagaaagagaaggtgaa
aaagagaaggcctcatggagagctgaaaaagatagggagtctcttcgtcgtactaaaaat
gagactgatgaagatggatggaccacagtacgacgttaa

DBGET integrated database retrieval system