KEGG   Macaca mulatta (rhesus monkey): 713451
Entry
713451            CDS       T01028                                 

Gene name
ALDH2
Definition
(RefSeq) aldehyde dehydrogenase, mitochondrial
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc00010  Glycolysis / Gluconeogenesis
mcc00053  Ascorbate and aldarate metabolism
mcc00071  Fatty acid degradation
mcc00280  Valine, leucine and isoleucine degradation
mcc00310  Lysine degradation
mcc00330  Arginine and proline metabolism
mcc00340  Histidine metabolism
mcc00380  Tryptophan metabolism
mcc00410  beta-Alanine metabolism
mcc00561  Glycerolipid metabolism
mcc00620  Pyruvate metabolism
mcc00770  Pantothenate and CoA biosynthesis
mcc01100  Metabolic pathways
Module
mcc_M00135  GABA biosynthesis, eukaryotes, putrescine => GABA
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    713451 (ALDH2)
   00053 Ascorbate and aldarate metabolism
    713451 (ALDH2)
   00620 Pyruvate metabolism
    713451 (ALDH2)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    713451 (ALDH2)
   00561 Glycerolipid metabolism
    713451 (ALDH2)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    713451 (ALDH2)
   00310 Lysine degradation
    713451 (ALDH2)
   00330 Arginine and proline metabolism
    713451 (ALDH2)
   00340 Histidine metabolism
    713451 (ALDH2)
   00380 Tryptophan metabolism
    713451 (ALDH2)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    713451 (ALDH2)
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    713451 (ALDH2)
Enzymes [BR:mcc01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     713451 (ALDH2)
SSDB
Motif
Pfam: Aldedh HetR_C
Other DBs
NCBI-GeneID: 713451
NCBI-ProteinID: XP_002808038
Ensembl: ENSMMUG00000008336
UniProt: A0A5K1TZ33
LinkDB
Position
11
AA seq 564 aa
MGRRGPAPGPPPPSHWRSRGAGSGVGSVALSPPSPALRPLAARYPAAMLRAAARFGPRLG
LRFLSAAATQAVPAPNQQPEVFCNKIFINNEWHNAVSRKTFPTVNPSTGEVICQVAEGDK
EDVDKAVKAARAAFQLGSPWRRMDASHRGRLLNRLADLIERDRTYLAALETLDNGKPYVT
SYLVDLDMVLKCLRYYAGWADKYHGKTIPIDGDFFSYTRHEPVGVCGQIIPWNFPLLMQA
WKLGPALATGNVVVMKVAEQTPLTALYVANLIKEAGFPPGVVNIVPGFGPTAGAAIASHE
DVDKVAFTGSTETGRLIQVAAGSSNLKRVTLELGGKSPNIIMSDADMDWAVEQAHFALFF
NQGQCCCAGSRTFVQEDIYDEFVERSVARAKSRVVGNPFDSKTEQGPQVDETQFKKILGY
INTGKQEGAKLLCGGGIAADRGYFIQPTVFGDVQDGMTIAKEEIFGPVMQILKFKTIEEV
VGRANNSTYGLAAAVFTKDLDKANYLSQALQAGTVWVNCYDVFGAQSPFGGYKMSGSGRE
LGEYGLQAYTEVKTITVKVPQKNS
NT seq 1695 nt   +upstreamnt  +downstreamnt
atgggaagacgcggccccgcccccggcccgcccccgccttcccattggcggtcgcgcggg
gcggggagcggggtcggctctgtggccctgagcccccctagccctgccctccgtccgctc
gcagcccgctatcctgctgccatgttgcgtgctgccgcccgcttcgggccccgcctgggc
ctccgcttcttgtcagccgccgccacccaggccgtgcccgcccccaaccagcagcccgag
gtcttctgcaacaagatcttcataaacaatgaatggcacaatgccgtcagcaggaaaaca
ttccccacagtcaatccgtccactggagaggtcatctgccaggtagctgaaggggacaag
gaagatgtggacaaggcagtgaaggccgcccgggccgccttccagctgggctcaccttgg
cgtcgcatggacgcgtcacacaggggccggctgctgaaccggctggctgatctgatcgag
cgggaccggacctacctggcggccttggagactctggacaatggcaaaccctatgtcacc
tcctacctggtggatttggacatggtcctcaaatgtctccggtattatgccggctgggct
gataagtaccacgggaaaaccattcccattgacggagacttcttcagctacacccgccat
gaacctgtgggggtgtgcgggcagatcattccgtggaatttcccgctcctgatgcaagca
tggaagctgggcccagccttggcgactggaaacgtggttgtgatgaaggtagctgagcag
acacccctcactgccctctatgtggccaacctgatcaaggaggccggctttccccctggt
gtggtcaacattgttcctggatttggccccacagccggggccgccatcgcctcccatgag
gatgtggacaaagtggcattcacaggctccaccgagactggccgcctcatccaggttgct
gccgggagcagcaatctcaagagagtgaccttggagctggggggaaagagccccaacatc
atcatgtcagatgccgacatggactgggccgtggagcaggcccacttcgccctgttcttc
aaccagggccaatgctgctgtgctggctcccggaccttcgtgcaggaggacatctatgac
gagtttgtggagcggagcgttgcccgggccaagtctcgggtggtcgggaacccctttgac
agcaagaccgagcaggggccgcaggtggatgaaactcagtttaagaagatcctcggctac
atcaacactgggaaacaagagggggcgaagctgctgtgtggtgggggcattgctgctgac
cgtggttacttcatccagcccaccgtgtttggagatgtgcaggatggcatgaccatcgcc
aaggaggagatcttcgggccagtgatgcagatcctgaagttcaagaccatagaggaagtt
gttgggagagccaacaattccacgtacgggctggccgcagctgtcttcacaaaggatttg
gacaaggccaattacctgtcccaggccctccaggcgggcaccgtgtgggtcaactgctat
gatgtgtttggagcccagtcaccctttggcggctacaagatgtcgggcagtggccgggag
ctgggcgagtacggcctgcaggcatacactgaagtgaaaactatcacagtcaaagtgcct
cagaagaactcataa

DBGET integrated database retrieval system