KEGG   Macaca mulatta (rhesus monkey): 713807
Entry
713807            CDS       T01028                                 

Gene name
CD4
Definition
(RefSeq) T-cell surface glycoprotein CD4 precursor
  KO
K06454  T-cell surface glycoprotein CD4
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04060  Cytokine-cytokine receptor interaction
mcc04514  Cell adhesion molecules
mcc04612  Antigen processing and presentation
mcc04640  Hematopoietic cell lineage
mcc04658  Th1 and Th2 cell differentiation
mcc04659  Th17 cell differentiation
mcc04660  T cell receptor signaling pathway
mcc05135  Yersinia infection
mcc05166  Human T-cell leukemia virus 1 infection
mcc05170  Human immunodeficiency virus 1 infection
mcc05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
mcc05340  Primary immunodeficiency
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    713807 (CD4)
   04514 Cell adhesion molecules
    713807 (CD4)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    713807 (CD4)
   04612 Antigen processing and presentation
    713807 (CD4)
   04660 T cell receptor signaling pathway
    713807 (CD4)
   04658 Th1 and Th2 cell differentiation
    713807 (CD4)
   04659 Th17 cell differentiation
    713807 (CD4)
 09160 Human Diseases
  09161 Cancer: overview
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    713807 (CD4)
  09163 Immune disease
   05340 Primary immunodeficiency
    713807 (CD4)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    713807 (CD4)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    713807 (CD4)
   05170 Human immunodeficiency virus 1 infection
    713807 (CD4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:mcc04090]
    713807 (CD4)
CD molecules [BR:mcc04090]
 Proteins
  713807 (CD4)
SSDB
Motif
Pfam: CD4-extracel C2-set ig V-set I-set Ig_3 Ig_2 Tcell_CD4_C Receptor_2B4 Herpes_gE Pilin
Other DBs
NCBI-GeneID: 713807
NCBI-ProteinID: NP_001036127
Ensembl: ENSMMUG00000013202
UniProt: P16003
LinkDB
Structure
PDB: 
6TYB

Position
11
AA seq 458 aa
MNRGIPFRHLLLVLQLALLPAVTQGKKVVLGKKGDTVELTCTASQKKNTQFHWKNSNQIK
ILGIQGLFLTKGPSKLSDRADSRKSLWDQGCFSMIIKNLKIEDSDTYICEVENKKEEVEL
LVFGLTANSDTHLLEGQSLTLTLESPPGSSPSVKCRSPGGKNIQGGRTISVPQLERQDSG
TWTCTVSQDQKTVEFKIDIVVLAFQKASSTVYKKEGEQVEFSFPLAFTLEKLTGSGELWW
QAERASSSKSWITFDLKNKEVSVKRVTQDPKLQMGKKLPLHLTLPQALPQYAGSGNLTLA
LEAKTGKLHQEVNLVVMRATQFQENLTCEVWGPTSPKLTLSLKLENKGATVSKQAKAVWV
LNPEAGMWQCLLSDSGQVLLESNIKVVPTWPTPVQPMALIVLGGVAGLLLFTGLGIFFCV
RCRHRRRQAERMSQIKRLLSEKKTCQCPHRFQKTCSPI
NT seq 1377 nt   +upstreamnt  +downstreamnt
atgaaccggggaatcccttttaggcacttgcttctggtgctgcaactggcgctactccca
gcagtcacccagggaaagaaagtggtgctgggcaagaaaggggatacagtggaactgacc
tgtacagcttcgcagaagaagaacacacaattccactggaaaaactccaaccagataaag
attctgggaattcagggtctcttcttaactaaaggtccatccaagctgagcgatcgtgct
gactcaagaaaaagcctttgggaccaaggatgcttttccatgatcatcaagaatcttaag
atagaagactcagatacttacatctgtgaagtggagaacaagaaggaggaggtggaattg
ctggtgttcggattgactgccaactctgacacccacctgcttgaggggcaaagcctgacc
ctgaccttggagagcccccctggtagtagcccctcagtgaaatgtaggagtccagggggt
aaaaacatacagggggggaggaccatctctgtgcctcagctggagcgccaggatagtggc
acctggacatgcaccgtctcgcaggaccagaagacggtggagttcaaaatagacatcgtg
gtgctagctttccagaaggcctccagcacagtctataagaaagagggggaacaggtggag
ttctccttcccactcgcctttacacttgaaaagctgacgggcagtggcgagctgtggtgg
caggcggagagggcctcctcctccaagtcttggattaccttcgacctgaagaacaaggaa
gtgtctgtaaaacgggttacccaggaccccaagctccagatgggcaagaagctcccgctc
cacctcaccctgccccaggccttgcctcagtatgctggctctggaaacctcacgctggcc
cttgaagcgaaaacaggaaagttgcatcaggaagtgaacctcgtggtgatgagagccact
cagttccaggaaaatttgacctgtgaagtgtggggacccacctcccctaagctgacgctg
agcttgaaactggagaacaagggggcaacggtctcgaagcaggcgaaggcggtgtgggtg
ctgaaccctgaggcggggatgtggcagtgtctgctgagtgactcgggacaggtcctgcta
gaatccaacatcaaggttgtgcccacatggcccaccccggtgcagccaatggccctgatt
gtgctggggggcgttgcgggcctcctgcttttcactgggctaggcatcttcttctgtgtc
aggtgccggcatcgaaggcgtcaagcagagcggatgtctcagatcaagagactcctcagt
gaaaagaagacctgccagtgccctcaccggtttcagaagacatgtagccccatttga

DBGET integrated database retrieval system