KEGG   Macaca mulatta (rhesus monkey): 713965
Entry
713965            CDS       T01028                                 

Gene name
BCAR1
Definition
(RefSeq) breast cancer anti-estrogen resistance protein 1 isoform X1
  KO
K05726  breast cancer anti-estrogen resistance 1
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04015  Rap1 signaling pathway
mcc04062  Chemokine signaling pathway
mcc04510  Focal adhesion
mcc04670  Leukocyte transendothelial migration
mcc04810  Regulation of actin cytoskeleton
mcc04935  Growth hormone synthesis, secretion and action
mcc05100  Bacterial invasion of epithelial cells
mcc05135  Yersinia infection
mcc05163  Human cytomegalovirus infection
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    713965 (BCAR1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    713965 (BCAR1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    713965 (BCAR1)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    713965 (BCAR1)
   04062 Chemokine signaling pathway
    713965 (BCAR1)
  09152 Endocrine system
   04935 Growth hormone synthesis, secretion and action
    713965 (BCAR1)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    713965 (BCAR1)
   05100 Bacterial invasion of epithelial cells
    713965 (BCAR1)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    713965 (BCAR1)
SSDB
Motif
Pfam: CAS_C Serine_rich SH3_1 SH3_9 SH3_2 Vinculin
Other DBs
NCBI-GeneID: 713965
NCBI-ProteinID: XP_014982114
Ensembl: ENSMMUG00000002630
UniProt: I0FWM3
LinkDB
Position
20
AA seq 888 aa
MHCPGEAPLAAPRPTPKDPCLRNVLAKALYDNVAESPDELSFRKGDIMTVLEQDTQGLDG
WWLCSLHGRQGIVPGNRLKILVGMYDKKPAGPGPGPPTIPAQPQPGLHAPAPPASQYTPM
LPTTYQPQPDSVYLVPTPSKAQQGLYQAPGPSPQFQSPPAKQTSTFSKQTPHHQFPSPAA
DLYQVPPGPGGPAQDIYQVPPSAGMGHDIYQVPPSMDTRSWEGTKPPAKVVVPTRVGQGY
VYEAAQPEQDEYDIPRHLLAPGSQDIYDVPPVRGLLPSQYGQEVYDTPPMAVKGPNGRDP
LLEVYDVPPSVEKGLPLSSHHAVYDVPPSVSKDVPDGPLLREETYDVPPAFAKAKPFDPA
RTPLVLAVPPPDSPPAEDVYDVPPPAPDLYDVPPGLRRPGPGTLYDVPRERVLPPELADG
GTVDNGVYAVPPPAEREAPADGKRLSASSTSSTRSSQSASSLEVAGPGREPLELEVAVEA
LARLQQGVSTTVAHLLDLAGSAGGTGSWRNPSEPQEPLVQDLQAAVAAVQSAVHELLEFS
RSAVGNAAHTSDRTLHAKLSRQLQKMEDVHQTLVAHGQAFDAGRGGPGATPEDLDRLVAC
SRAVPEDAKQLASFLHGNASLLFRRTKAPAPGPEGGGTLHPNPTDKTSSIQSRPLPSPPK
FTSQDSPDGQYENSEGGWMEDYDYVHLQGKEEFEKTQKELLEKGSITRQGKSQLELQQLK
QFERLEQEVSRPIDHDLANWTPAQPLAPGRTGGLGPSDRQLLLFYLEQCEANLTTLTNAV
DAFFTAVATNQPPKIFVAHSKFVILSAHKLVFIGDTLSRQAKAADVRSQVTHYSNLLCDL
LRGIVATTKAAALQYPSPAAAQDMVERVKELGHSTQQFRRVLGQLAAA
NT seq 2667 nt   +upstreamnt  +downstreamnt
atgcactgccctggtgaggctcctctggctgcccccaggcccacacccaaggatccctgc
ctcagaaacgtgctggctaaagccctctatgacaacgtggccgagtccccagatgagctg
tccttccgaaagggtgacatcatgacggtgctggagcaggacacgcagggcctggacggc
tggtggctctgctcactgcacgggcgccagggcatcgttcctgggaaccgcctcaagatc
ttggtgggcatgtatgataagaagccagcagggcctggccccggcccccccaccatcccg
gcccagcctcagcctggcctccacgccccggcgcctccggcctcccagtacacgcccatg
ctccccaccacctaccagccccagcctgacagtgtctacctggtgcccactcccagcaag
gctcagcaaggcctctaccaagccccgggtcccagccctcagttccagtcgcccccagcc
aagcagacatccaccttctcgaagcagacgccccatcaccagtttcccagccccgccgca
gacctgtatcaagtgcccccagggcctggaggccccgcccaggacatttaccaggtgccg
ccttctgccgggatggggcatgacatctaccaggtccccccgtccatggacacacgcagc
tgggagggcacaaagcccccggcaaaggtggtggtgcccacccgcgtggggcagggctac
gtgtatgaggccgcccagccggagcaggacgagtacgacatcccgcgacacctgctggcc
ccggggtcacaggacatctatgatgtgcccccggttcgggggctgcttcccagccagtat
ggccaggaggtgtatgacacgccccccatggctgtcaagggtcccaatggccgagacccg
ttgctggaggtgtatgacgtgccccccagcgtggagaagggcctgccactgtccagccac
cacgcggtctatgacgttcctccatcggtgagcaaggatgtgcctgatggcccgctgctc
cgtgaggagacctacgatgtgccccccgccttcgctaaggccaagccctttgacccggcc
cgcaccccactggtcctggctgtgccccctccagactccccgccggccgaggacgtgtat
gacgtgccgcccccggctcctgacctctacgacgtgccccctggcttgcggcggcctggc
ccaggcaccctgtatgatgtgccccgtgaacgggtgcttcctcctgagttggctgatggt
ggcacggttgacaacggtgtgtatgcggtgcctcccccagctgaacgtgaagccccggcg
gatggcaagcgcctttcggcctccagcaccagcagcacacgtagcagccagtccgcatcc
tccttggaggtggcggggccgggccgggaacccctggagctggaagttgccgtggaggcc
ctggcacggctgcagcagggtgtgagcaccaccgttgcccaccttctggacctggcaggc
agcgctggtgggactgggagctggcgtaacccctctgagccgcaggagccgctggtgcag
gacctgcaggctgctgtggctgccgtccagagtgccgtccacgagctgttggagttttcc
cgcagcgccgtgggcaatgctgcccacacatctgaccgcaccctgcatgccaagcttagc
cggcaactacagaagatggaggacgtgcaccagacgctggtggcacacggtcaggctttt
gacgctggccggggaggccctggagccacccctgaggacctggaccggctggtggcctgc
tcgagggctgtgcccgaggacgccaagcagctggcctccttcctgcacggcaatgcctca
ctgctcttcagacggaccaaggcccccgctccggggcctgaggggggtggcaccctgcac
cccaaccccactgacaagaccagcagcatccagtcacggcccctgccctcaccccctaag
ttcacctcccaggactcgccagatgggcagtacgagaacagcgaggggggctggatggag
gactatgactacgtccacctgcaggggaaggaggagtttgaaaagacccagaaggagctg
ctggaaaagggcagcatcacgcggcagggcaagagccagctggagctgcagcagctgaag
caatttgaacgactggaacaggaggtgtcgcggcccatagaccacgacttggccaactgg
acaccagcccaacccttggccccggggcggacaggcggcctggggccctcggaccggcag
ctgctgctcttctacctggagcagtgtgaggccaacctgaccacactgaccaatgccgtg
gacgccttcttcaccgccgtggccaccaaccagccacccaagatctttgtggcgcacagc
aaattcgtcatccttagcgcccacaagctggtgttcattggggacacactgtcacggcag
gccaaggctgctgacgtgcgcagccaggtgacccactacagcaacctgctgtgcgacctc
ctgcgtggcatcgtggccaccaccaaggccgccgccttgcagtacccatcacctgctgct
gcccaggacatggtagagagggtcaaggagctgggccacagcacccagcagttccgccgc
gtcctaggccagctggcagccgcctga

DBGET integrated database retrieval system