KEGG   Macaca mulatta (rhesus monkey): 714000Help
Entry
714000            CDS       T01028                                 

Gene name
CDC23
Definition
(RefSeq) cell division cycle 23
  KO
K03355  anaphase-promoting complex subunit 8
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04110  Cell cycle
mcc04114  Oocyte meiosis
mcc04120  Ubiquitin mediated proteolysis
mcc04914  Progesterone-mediated oocyte maturation
mcc05166  HTLV-I infection
Module
mcc_M00389  APC/C complex
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    714000 (CDC23)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    714000 (CDC23)
   04114 Oocyte meiosis
    714000 (CDC23)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    714000 (CDC23)
 09160 Human Diseases
  09167 Infectious diseases
   05166 HTLV-I infection
    714000 (CDC23)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:mcc04121]
    714000 (CDC23)
   03036 Chromosome and associated proteins [BR:mcc03036]
    714000 (CDC23)
Ubiquitin system [BR:mcc04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   APC/C
    Other subunits
     714000 (CDC23)
Chromosome and associated proteins [BR:mcc03036]
 Eukaryotic Type
  Sister chromatid separation proteins
   APC/C complex
    714000 (CDC23)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ANAPC8 TPR_1 TPR_2 TPR_8 TPR_14 TPR_19 TPR_11 TPR_7 TPR_17 TPR_16 ANAPC3 TPR_12 TPR_9 DUF772 TPR_15
Motif
Other DBs
NCBI-GeneID: 714000
NCBI-ProteinID: NP_001244486
Ensembl: ENSMMUG00000001515
UniProt: H9G187
LinkDB All DBs
Position
6
AA seq 597 aa AA seqDB search
MAASTSVVPVVVTAAVAPVLSTNSDFSDLREIKKQLLLIAGLTRERGLLHSSKWSAELAF
SLPALPLAELQPPPPITEEDAQDMDAYTLAKAYFDVKEYDRAAHFLHGCDSKKAYFLYMY
SRYLSGEKKKDDETVDSLGPLEKGQVKNEALRELRVELSKKHQARELDGFGLYLYGVVLR
KLDLVKEAIDVFVEATHVLPLHWGAWLELCNLITDKEMLKFLSLPDTWMKEFFLAHIYTE
LQLIEEALQKYQNLIDVGFSKSSYIVSQIAVAYHNIRDIDKALSIFNELRKQDPYRIENM
DTFSNLLYVRSMKSELSYLAHNLCEIDKYRVETCCVIGNYYSLRSQHEKAALYFQRALKL
NPRYLGAWTLMGHEYMEMKNTSAAIQAYRHAIEVNKRDYRAWYGLGQTYEILKMPFYCLY
YYRRAHQLRPNDSRMLVALGECYEKLNQLVEAKKCYWRAYAVGDVEKMALVKLAKLHEQL
TESEQAAQCYIKYIQDIYSCGEIVEHLEESTAFRYLAQYYFKCKLWDEASTCAQKCCAFN
DTREEGKALLRQILQLRNQGETPTTEVSAPFFLPASLSANNTPTRRVSPLNLSSVTP
NT seq 1794 nt NT seq  +upstreamnt  +downstreamnt
atggctgcgagtacctccgtagtcccggtggttgtgacggcggcagtggcgcctgtcctg
tccacaaacagcgatttctcagatttgcgggaaattaaaaagcaactgctgcttattgcg
ggccttactcgggagcggggcctactgcacagtagcaaatggtcggcggagttggctttc
tctcttcccgcattgcctctggccgagctgcaaccgcctccgcctattacagaggaggat
gcccaggatatggatgcctataccctggccaaggcctactttgatgttaaagagtatgat
cgggcagcacattttctgcatggctgcgatagcaagaaagcctattttctgtatatgtat
tccagatatctgtctggagaaaaaaagaaggatgatgaaacagttgatagcttaggcccc
ctggaaaaaggacaagtgaaaaatgaggctcttagagaattgagagtggaactcagcaaa
aaacaccaagctcgagaacttgatggatttggactttatctgtatggtgtggtgcttcga
aaactggacttggtgaaagaggccattgatgtgtttgtggaagctactcatgttttgccc
ttgcattggggagcctggttagaactctgtaacctgatcacagacaaagagatgctgaag
ttcctgtctttgccagacacctggatgaaagagttttttctggctcatatatacacagag
ttgcagttgatagaggaggccctgcaaaagtatcagaatctcatcgatgtgggcttctct
aagagctcatatattgtttcccaaattgcagttgcctatcacaatatcagagatattgac
aaagccctctccatttttaatgagctaaggaaacaagacccttacaggattgaaaatatg
gacacattctccaaccttctttatgtcaggagcatgaaatcggagttgagttatctggct
cataacctctgtgagattgataagtatcgtgtagaaacatgctgtgtaattggcaattat
tacagtttacgttctcagcatgagaaagcagccttgtatttccagagagccctgaaatta
aatcctcggtatcttggtgcctggacactgatgggacatgagtacatggagatgaagaac
acgtctgctgctatccaggcatatagacatgccattgaggtcaacaagcgggactacaga
gcttggtatggccttgggcagacctatgaaatccttaagatgccattttactgcctttat
tattatagacgggcccaccagcttcgacccaatgattctcgcatgctggttgctttagga
gaatgttacgagaaactcaatcaactagtggaagccaaaaagtgttattggagagcttac
gccgtgggagatgtggagaaaatggctctggtgaaactggcaaagcttcatgaacagttg
actgagtcagaacaggctgcccagtgttacatcaaatatatccaagatatctattcctgt
ggggaaatagtagaacacttagaagaaagcactgcttttcgctatctggcccagtactat
tttaagtgcaaactgtgggatgaagcttcaacttgtgcacaaaagtgttgtgcattcaat
gatacccgggaagaaggtaaggccttactccggcaaatcctacagcttcggaaccaaggc
gagactcctaccaccgaggtgtctgctccctttttcctgcctgcttcactctctgctaac
aacacccccacacgcagagtttctccactcaacttgtcttctgtcacgccatag

DBGET integrated database retrieval system