KEGG   Macaca mulatta (rhesus monkey): 714203
Entry
714203            CDS       T01028                                 

Gene name
AGT
Definition
(RefSeq) angiotensinogen isoform X2
  KO
K09821  angiotensinogen
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04072  Phospholipase D signaling pathway
mcc04080  Neuroactive ligand-receptor interaction
mcc04261  Adrenergic signaling in cardiomyocytes
mcc04270  Vascular smooth muscle contraction
mcc04614  Renin-angiotensin system
mcc04924  Renin secretion
mcc04925  Aldosterone synthesis and secretion
mcc04927  Cortisol synthesis and secretion
mcc04931  Insulin resistance
mcc04933  AGE-RAGE signaling pathway in diabetic complications
mcc04934  Cushing syndrome
mcc05200  Pathways in cancer
mcc05410  Hypertrophic cardiomyopathy
mcc05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04072 Phospholipase D signaling pathway
    714203 (AGT)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    714203 (AGT)
 09150 Organismal Systems
  09152 Endocrine system
   04924 Renin secretion
    714203 (AGT)
   04614 Renin-angiotensin system
    714203 (AGT)
   04925 Aldosterone synthesis and secretion
    714203 (AGT)
   04927 Cortisol synthesis and secretion
    714203 (AGT)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    714203 (AGT)
   04270 Vascular smooth muscle contraction
    714203 (AGT)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    714203 (AGT)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    714203 (AGT)
   05414 Dilated cardiomyopathy
    714203 (AGT)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    714203 (AGT)
   04933 AGE-RAGE signaling pathway in diabetic complications
    714203 (AGT)
   04934 Cushing syndrome
    714203 (AGT)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:mcc01002]
    714203 (AGT)
Peptidases and inhibitors [BR:mcc01002]
 Peptidase inhibitors
  Family I4: serpin family
   714203 (AGT)
SSDB
Motif
Pfam: Serpin
Other DBs
NCBI-GeneID: 714203
NCBI-ProteinID: XP_014981524
Ensembl: ENSMMUG00000005881
LinkDB
Position
1
AA seq 490 aa
MIFQGMQKRAPQSEMAPASVSLRATILCLLAWAGLATGDRVYIHPFHLVIHNESTCEQLA
KANAGKPKDPTFTPVPIQAKTSPVDEKALQDQLVLVAAKLDTEDKLRAAMVGMLANFLGF
RIYGMHSELWGVVHGATILSPTAVFGTLASLYLGALDHTADRLQAILGVPWKDKNCTSRL
DAHKVLSALQAVQGLLVAQGRADGQSQLLLSTVVGLFTAPDLHLKQPFVQGLALYAPVVL
PRSLDFTDLEVAAEKIDRFMQAVTGWKISSPLTGASADSTLVFNTYVHFQGKMRDFFLLA
EPQEFWVDNSTSVSVPMLSGVGTFQHWSDAQDNFSVTQVPFTESACLLLIQPHYASDLDK
VEGLTFQQNSLNWMKKLSPRAIHLTMPRLVLRGSYDLQDLLAQAELPAILGTELNLQKLS
NDDLRVGKVLNSIFFELEADEREPTESTRQLNRPEFLEVTLDRPFLFAVYDQSATALHFL
GRVANPLSPA
NT seq 1473 nt   +upstreamnt  +downstreamnt
atgatatttcagggtatgcagaagcgagcaccccagtccgagatggctcctgccagcgtg
agcctgagggccaccatcctctgcctcctggcctgggctggcctggccacaggtgaccgg
gtgtacatacaccccttccacctcgtcatccacaatgagagtacctgtgagcagctggca
aaggccaatgctgggaagcccaaagatcccaccttcacacctgttccgatacaggccaag
acgtcccctgtggatgaaaaggccctgcaggaccagctagtgctggtcgctgcaaaactc
gacaccgaggacaagttgagagccgcgatggtcgggatgctggccaacttcttgggcttc
cgtatatatggcatgcacagtgagctatggggcgtggtccatggggccaccatcctctcc
ccaacggctgtctttggcaccctggcctctctctacctgggagcgttggaccacacagcc
gacaggctacaggcaatcctgggcgtcccttggaaggacaagaactgcacctcccggctg
gatgcgcacaaggtcctctctgccctgcaggctgtacagggcctgctggtggcccagggc
agggctgacggccagtcccagctgctgttgtccacagtggtgggtctcttcacagcccca
gatctgcacctgaagcagccgtttgtgcagggcctggctctctatgcccctgtggtcctc
ccacgctctctggacttcacagacctggaagtcgctgctgagaagattgacaggttcatg
caggctgtgacaggatggaagattagcagccccctgacgggagccagtgcggacagcacc
ctggttttcaacacctacgtccatttccaagggaagatgagggacttcttcctgctggct
gagccccaggagttctgggtggacaacagcacctcagtgtctgtccccatgctgtctggc
gtgggcaccttccagcactggagcgacgcccaggacaacttctcagtgactcaagtgccc
tttactgagagcgcctgcttgctgctgattcagcctcactacgcctctgacctggacaag
gtggagggtctcactttccagcaaaactccctcaactggatgaagaaactgtctccccgg
gccatccacctgaccatgccccgactggtgctgcgaggatcttatgacctgcaggacctg
cttgcccaggctgagctgcccgccattctgggcaccgagctgaacctgcaaaaattgagc
aatgacgacctcagggtggggaaggtgctgaacagcattttttttgaactcgaagcggat
gagagagagcccacagagtctacccgacagctgaacaggcctgagttcttggaggtgacc
ctggaccgcccattcctgtttgctgtgtatgatcaaagtgccactgccctgcacttcctg
ggccgtgtggccaacccgctgagcccagcatga

DBGET integrated database retrieval system