KEGG   Macaca mulatta (rhesus monkey): 714231
Entry
714231            CDS       T01028                                 

Gene name
NOS3
Definition
(RefSeq) nitric oxide synthase, endothelial isoform X1
  KO
K13242  nitric-oxide synthase, endothelial [EC:1.14.13.39]
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc00220  Arginine biosynthesis
mcc00330  Arginine and proline metabolism
mcc01100  Metabolic pathways
mcc04020  Calcium signaling pathway
mcc04022  cGMP-PKG signaling pathway
mcc04066  HIF-1 signaling pathway
mcc04071  Sphingolipid signaling pathway
mcc04151  PI3K-Akt signaling pathway
mcc04370  VEGF signaling pathway
mcc04371  Apelin signaling pathway
mcc04611  Platelet activation
mcc04915  Estrogen signaling pathway
mcc04921  Oxytocin signaling pathway
mcc04926  Relaxin signaling pathway
mcc04931  Insulin resistance
mcc04933  AGE-RAGE signaling pathway in diabetic complications
mcc05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    714231 (NOS3)
   00330 Arginine and proline metabolism
    714231 (NOS3)
 09130 Environmental Information Processing
  09132 Signal transduction
   04370 VEGF signaling pathway
    714231 (NOS3)
   04371 Apelin signaling pathway
    714231 (NOS3)
   04066 HIF-1 signaling pathway
    714231 (NOS3)
   04020 Calcium signaling pathway
    714231 (NOS3)
   04071 Sphingolipid signaling pathway
    714231 (NOS3)
   04022 cGMP-PKG signaling pathway
    714231 (NOS3)
   04151 PI3K-Akt signaling pathway
    714231 (NOS3)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    714231 (NOS3)
  09152 Endocrine system
   04915 Estrogen signaling pathway
    714231 (NOS3)
   04921 Oxytocin signaling pathway
    714231 (NOS3)
   04926 Relaxin signaling pathway
    714231 (NOS3)
 09160 Human Diseases
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    714231 (NOS3)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    714231 (NOS3)
   04933 AGE-RAGE signaling pathway in diabetic complications
    714231 (NOS3)
Enzymes [BR:mcc01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.13  With NADH or NADPH as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.13.39  nitric-oxide synthase (NADPH)
     714231 (NOS3)
SSDB
Motif
Pfam: NO_synthase FAD_binding_1 Flavodoxin_1 NAD_binding_1 HTH_15
Other DBs
NCBI-GeneID: 714231
NCBI-ProteinID: XP_014990773
Ensembl: ENSMMUG00000020437
UniProt: F6WEB2
LinkDB
Position
3
AA seq 1205 aa
MGNLKSVAQEPGPPCGLGLGLGLGLCGKQGPATSAPEPSRAPASLPPPAPEHSPPSSPLT
QPPEGPKFPRVKNWEVGSIAYDTLSAQAQQDGPCTPRRCLGSLVFPRKLQGRPSPGPPAP
EQLLSQARDFINQYYSSIRRSGSQAHEQRLQEVEAEVAATGTYQLRESELVFGAKQAWRN
APRCVGRIQWGKLQVFDARDCRSAQEMFTYICNHIKYATNRGNLRSAITVFPQRCPGRGD
FRIWNSQLVRYAGYRQQDGSVRGDPANVEITELCIQHGWTPGNGRFDVLPLLLQAPDEPP
ELFLLPPELVLEVPLEHPTLEWFAALGLRWYALPAVSNMLLEIGGLEFPAAPFSGWYMST
EIGTRNLCDPHRYNILEDVAVCMDLDTRTTSSLWKDKAAVEINVAVLHSYQLAKVTIVDH
HAATASFMKHLENEQKARGGCPADWAWIVPPISGSLTPVFHQEMVNYFLSPAFRYQPDPW
KGSAAKGTGITRKKTFKEVANAVKISASLMGTVMAKRVKATILYGSETGRAQSYAQQLGR
LFRKAFDPRVLCMDEYDVVSLEHETLVLVVTSTFGNGDPPENGESFAAALMEMSGPYNSS
PRPEQHKSYKIRFNSISCSDPLVSSWRRKRKESSNTDSAGALGTLRFCVFGLGSRAYPHF
CAFARAVDTRLEELGGERLLQLGQGDELCGQEEAFRGWAQAAFQAACETFCVGEDAKAAA
RDIFSPKRSWKRQRYRLSAQAEGLQLLPGLIHVHRRKMFQATILSVENLQSSKSTRATIL
VRLDTGGQEGLQYQPGDHIGVCPPNRPGLVEALLSRVEDPPAPTEPVAVEQLEKGSPGGP
PPSWVRDPRLPPCTLRQALTFFLDITSPPSPQLLRLLSTLAEEPREQQELEALSQDPRRY
EEWKWFRCPTLLEVLEQFPSVALPAPLLLTQLPLLQPRYYSVSSAPSTHPGEIHLTVAVL
AYRTQDGLGPLHYGVCSTWLSQLKPGDPVPCFIRGAPSFRLPPDPSLPCILVGPGTGIAP
FRGFWQERLHDIESKGLQPTPMTLVFGCRCSQLDHLYRDEVQNAQQRGVFGRVLTAFSRE
PDNPKTYVQDILRTELAAEVHRVLCLERGHMFVCGDVTMATNVLQTVQRILATEGDMELD
EAGDVIGVLRDQQRYHEDIFGLTLRTQEVTSRIRTQSFSLQERQLRGAVPWAFDPPGSDT
NTNGP
NT seq 3618 nt   +upstreamnt  +downstreamnt
atgggcaacttgaagagcgtggcccaggaacctgggccaccctgtggcctggggctgggg
ctgggccttgggctgtgcggcaagcagggcccagccacctcagcccctgagcccagccgg
gccccggcatccctacccccgccagcaccagaacacagccccccgagctccccgctaacc
cagcccccggaggggcccaagttccctcgtgtgaagaactgggaggtggggagcatcgcc
tatgacaccctcagcgcccaggcgcagcaggatgggccctgcaccccaagacgctgcctg
ggctccctggtatttccacggaaactacagggccggccctcccctggccccccggcccct
gagcagctgctgagtcaggcccgggacttcatcaaccagtactacagctccatcaggagg
agcggctcccaggcccacgaacagcggcttcaagaggtggaagccgaggtggcagccaca
ggcacctaccagcttagggagagcgagctcgtgttcggggccaagcaggcctggcgcaac
gctccccgctgtgtgggccggatccagtgggggaagctgcaggtgttcgatgcccgggac
tgcaggtcggcacaggaaatgttcacctacatctgcaaccacatcaaatacgccaccaac
cggggcaaccttcgctcggccatcacagtgttcccgcagcgctgccctggccgaggagac
ttccgaatctggaacagccagctggtgcgctatgcgggctaccggcagcaggacggctct
gtgcggggggacccagccaacgtcgagatcaccgagctctgcattcagcatggctggacc
ccaggaaacggtcgctttgacgtgctgcccctgctgctgcaggccccggatgagccccca
gaactcttccttctgccccctgagctggtccttgaggtgcccctggagcaccctacgctg
gagtggtttgcagccctgggcctgcgctggtacgccctcccagcagtgtccaacatgctg
ctggaaattgggggcctggagttccccgcagcccccttcagtggctggtacatgagcact
gagatcggcacgaggaacctgtgtgaccctcaccgctacaacatcctggaggacgtggct
gtctgcatggacctggatacccggacaacttcgtccctatggaaagacaaggcagcggtg
gaaatcaacgtggccgtgctgcacagttaccagctggccaaagtcaccattgtggaccac
cacgctgccacagcctccttcatgaagcacctggagaatgagcagaaggccagggggggc
tgccctgcagactgggcctggatcgtgccccccatctcgggcagcctcactcctgtcttc
catcaggagatggtcaactatttcctgtcaccagccttccgctaccagccagacccctgg
aaggggagtgcggccaagggcaccggcatcaccaggaagaagacctttaaagaagtggcc
aatgccgtgaagatctctgcctcgctcatgggcaccgtgatggcgaagcgagtgaaggcg
acaatcctgtatggctccgagaccggccgggcccagagctacgcacagcagctggggaga
cttttccggaaggcttttgatccccgggtcctgtgtatggatgagtatgacgtggtgtcc
ctcgaacacgagacgctggtgctggtggtaaccagcacattcgggaatggggatcccccg
gagaatggagagagctttgcagctgccctgatggagatgtccggtccctacaacagctcc
cctcggccggaacagcacaagagttataagatccgcttcaacagcatctcctgctcagac
ccactggtgtcctcttggcggcggaagaggaaggagtccagtaacacagacagtgcaggg
gccctgggcacactcaggttctgtgtgttcgggctgggctcccgggcctacccccacttc
tgcgcctttgctcgtgcggtggacacgcggctggaggaactgggcggggagcggctgctg
cagctgggccagggcgacgagctgtgtggccaggaggaggccttccgcggctgggcccag
gctgccttccaggccgcctgtgagaccttctgtgtgggagaggatgccaaggctgctgcc
cgagacatcttcagccccaaaaggagttggaagcgccagaggtaccggctgagcgcccag
gccgagggcctgcagttgctgccaggtctgatccacgtgcacaggcggaagatgttccag
gctacaattctctcagtggaaaacctgcaaagcagcaagtccacgagggccaccatcctg
gtgcgcctggacactggaggccaggaggggctgcagtaccagccgggggatcacataggt
gtctgcccacccaaccggcccggccttgtggaggcgctgctgagccgcgtggaggacccg
cctgcgcccaccgagcctgtggcagtagagcaactggagaagggcagccctggtggccct
ccccccagctgggtgcgggacccccggctgcccccatgcacgctgcgccaggctctcacc
ttcttcctggacatcacctccccgcccagccctcagctcttgcggctgctcagcaccttg
gcagaagagcccagggaacagcaggagctggaggccctcagtcaggatccccgacgctac
gaggagtggaagtggttccgctgccccacgctgctggaggtgctggagcagttcccgtcg
gtggcactgcctgccccactgctcctcacccagctgcctctgctccaaccccggtactat
tcagtcagctcagcacccagcacccacccaggagagatccacctcactgtagctgtgctg
gcatacaggacccaggatgggctgggccccctgcactatggagtctgctccacgtggcta
agccaactcaagcccggagaccctgtgccctgcttcatccggggggctccctccttccgg
ctgccacctgatcccagcttgccctgcatcctggtgggcccaggcactggcattgccccc
ttccggggattctggcaggagcggctgcatgacattgagagcaaagggctgcagcccact
cccatgactttggtgtttggctgccgatgctcccaactcgaccatctctaccgcgacgag
gtgcagaacgcccagcagcgcggggtgtttggccgagtcctcaccgccttctcccgggaa
cctgacaaccccaagacctacgtgcaggacatcctgaggaccgagctggctgcggaggtg
caccgcgtgctgtgcctcgagcggggccacatgtttgtctgcggcgatgtcaccatggca
accaacgtcctgcagaccgtgcagcgcatcctggcaacggagggcgacatggagctggac
gaggccggcgacgtcatcggcgtgctgcgggatcagcaacgctaccacgaagacattttc
gggctcacgctgcgcacccaggaggtgacaagccgcatacgcacccagagcttttccttg
caggagcggcagctacggggcgcagtgccctgggcgttcgacccgcccggctcggacacc
aacaccaacggcccctga

DBGET integrated database retrieval system