KEGG   Macaca mulatta (rhesus monkey): 714399
Entry
714399            CDS       T01028                                 

Gene name
CD38
Definition
(RefSeq) ADP-ribosyl cyclase/cyclic ADP-ribose hydrolase 1
  KO
K01242  ADP-ribosyl cyclase 1 [EC:3.2.2.6 2.4.99.20]
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc00760  Nicotinate and nicotinamide metabolism
mcc01100  Metabolic pathways
mcc04020  Calcium signaling pathway
mcc04640  Hematopoietic cell lineage
mcc04921  Oxytocin signaling pathway
mcc04970  Salivary secretion
mcc04972  Pancreatic secretion
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    714399 (CD38)
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    714399 (CD38)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    714399 (CD38)
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    714399 (CD38)
  09154 Digestive system
   04970 Salivary secretion
    714399 (CD38)
   04972 Pancreatic secretion
    714399 (CD38)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:mcc04090]
    714399 (CD38)
   00536 Glycosaminoglycan binding proteins [BR:mcc00536]
    714399 (CD38)
Enzymes [BR:mcc01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.99  Transferring other glycosyl groups
    2.4.99.20  2'-phospho-ADP-ribosyl cyclase/2'-phospho-cyclic-ADP-ribose transferase
     714399 (CD38)
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.6  ADP-ribosyl cyclase/cyclic ADP-ribose hydrolase
     714399 (CD38)
CD molecules [BR:mcc04090]
 Proteins
  714399 (CD38)
Glycosaminoglycan binding proteins [BR:mcc00536]
 Hyaluronan
  Cell surface receptors
   714399 (CD38)
SSDB
Motif
Pfam: Rib_hydrolayse
Other DBs
NCBI-GeneID: 714399
NCBI-ProteinID: NP_001248702
Ensembl: ENSMMUG00000015298
UniProt: F6QEE7 G7MSL7
LinkDB
Position
5
AA seq 301 aa
MANCEFSPVSGDKPCCRLSRRAQVCLGVCLLVLLILVVVVAVVLPRWRQQWSGSGTTSRF
PETVLARCVKYTEVHPEMRHVDCQSVWDAFKGAFISKYPCNITEEDYQPLVKLGTQTVPC
NKTLLWSRIKDLAHQFTQVQRDMFTLEDMLLGYLADDLTWCGEFNTFEINYQSCPDWRKD
CSNNPVSVFWKTVSRRFAETACGVVHVMLNGSRSKIFDKNSTFGSVEVHNLQPEKVQALE
AWVIHGGREDSRDLCQDPTIKELESIISKRNIRFFCKNIYRPDKFLQCVKNPEDSSCLSG
I
NT seq 906 nt   +upstreamnt  +downstreamnt
atggccaactgcgagttcagcccggtgtccggggacaaaccctgctgccggctctctagg
agagcccaagtctgtcttggcgtctgtctcctggtcctcctgatcctcgtcgtggtggtc
gcggtggtcctcccgaggtggcgccagcagtggagcgggtcgggcacaaccagccgcttt
cctgagaccgtcctggcacgatgcgtcaagtacactgaagtccatcctgagatgagacat
gtagactgccaaagtgtatgggatgcattcaagggtgcatttatttcaaaatatccttgc
aacattacagaagaagactatcagccactagtgaagttgggaactcagaccgtaccttgc
aacaagactcttctttggagcagaataaaagatctggcccatcagttcacacaggtccag
cgggacatgttcaccctggaggacatgctgctaggctaccttgctgatgacctcacatgg
tgtggagaattcaacactttcgaaataaactatcaatcttgcccagactggagaaaggac
tgcagcaacaaccctgtttcggtattctggaaaacggtttcccgcaggtttgcagaaact
gcctgtggtgtggtccatgtgatgctcaatggatcccgcagtaaaatctttgacaaaaac
agcacttttgggagtgtggaagtccataatttgcaaccagagaaggttcaggcactagag
gcctgggtgatacatggtggaagagaagattccagagacttatgccaggatcccaccata
aaagagctggaatcgattataagcaaaaggaatattagatttttctgcaagaatatctac
agacctgacaagtttcttcagtgtgtgaaaaatcctgaggattcttcttgcctatctggg
atctga

DBGET integrated database retrieval system