KEGG   Macaca mulatta (rhesus monkey): 714645
Entry
714645            CDS       T01028                                 

Gene name
TSC1
Definition
(RefSeq) hamartin isoform X1
  KO
K07206  tuberous sclerosis 1
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04072  Phospholipase D signaling pathway
mcc04140  Autophagy - animal
mcc04150  mTOR signaling pathway
mcc04151  PI3K-Akt signaling pathway
mcc04152  AMPK signaling pathway
mcc04211  Longevity regulating pathway
mcc04218  Cellular senescence
mcc04714  Thermogenesis
mcc04910  Insulin signaling pathway
mcc05163  Human cytomegalovirus infection
mcc05165  Human papillomavirus infection
mcc05168  Herpes simplex virus 1 infection
mcc05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04072 Phospholipase D signaling pathway
    714645 (TSC1)
   04151 PI3K-Akt signaling pathway
    714645 (TSC1)
   04152 AMPK signaling pathway
    714645 (TSC1)
   04150 mTOR signaling pathway
    714645 (TSC1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    714645 (TSC1)
  09143 Cell growth and death
   04218 Cellular senescence
    714645 (TSC1)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    714645 (TSC1)
  09149 Aging
   04211 Longevity regulating pathway
    714645 (TSC1)
  09159 Environmental adaptation
   04714 Thermogenesis
    714645 (TSC1)
 09160 Human Diseases
  09161 Cancer: overview
   05231 Choline metabolism in cancer
    714645 (TSC1)
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    714645 (TSC1)
   05163 Human cytomegalovirus infection
    714645 (TSC1)
   05165 Human papillomavirus infection
    714645 (TSC1)
SSDB
Motif
Pfam: Hamartin
Other DBs
NCBI-GeneID: 714645
NCBI-ProteinID: XP_014971951
Ensembl: ENSMMUG00000009918
LinkDB
Position
15
AA seq 1169 aa
MAQQANVGELLAMLDSPMLGVRDDVTAVFKENLNSDRGPMLVNTLVDYYLETNSQPALHI
LTTLQEPHDKHLLDRINEYVGKAATRLSILSLLGHVIRLQPSWKHKLSQAPLLPSLLKCL
KMDTDVVVLTTGVLVLITMLPMIPQSGKQHLLDFFDIFGRLSSWCLKKPGHVAEVYLVHL
HASVYALFHRLYGMYPCNFVSFLRSHYSMKENLETFEEVVKPMMEHVRIHPELVTGSKDH
ELDPRRWKRLETHDVVIECAKISLDPTEASYEDGYSVSHQISARFPHRSADVTTSPYVDT
QNSYGCATSTPYSTSRLMLLNTPGQLPQTLSSPSTRLITEPPQVWCQLATLWSPSMVCGM
TTPPTSPGNVPPDLSHPYSKVFGTTAGGKGTPLGTPATSPPPAPLCHSDDYVHISLPQAT
ATPPRKEERMDSARPCLHRQHHLLNDRGSEEPPGSKGSVTLSDLPGFLGDLASEEDSIEK
DKEEAAISRELSEITTAEAEPVVPRGGFDSPFYRESLPGSQRKTHSAASSAQGASVNPEP
LHSSLDKLGPDTPKQAFTPIDLPCGGAEESPAGDRECQTSLETSILTPSPCKIPPSTRVG
FGSGQPPPYDHLFEVALPKTAHHFVIGKTEELLKKAKGSTEEDGVPSTSPMEVLDRLIQQ
GADAHSKELNKLPLPSKSVDWTHFGGSPPSDEIRTLRDQLLLLHNQLLYERFKRQQHALR
NRRLLRKVIKAAALEEHNAAMKDQLKLQEKDIQMWKVSLQKEQARYSQLQEQRDTMVTKL
HSQIRQLQHDREEFYNQSQELQTKLEDCRNMIAELRIELKKANNKVCHTELLLSQVSQKL
SNSESVQQQMEFLNRQLLVLGEVNELYLEQLQNKHSDTTKEVEMMKAAYRKELEKNRSHV
LQQTQRLDTSQKRILELESHLAKKDHLLLEQKKYLEDVKLQARGQLQAAESRYEAQKRIT
QVFELEILDLYGRLEKDGLLKKLEEEKAEAAEAAEERLDCCNDGCSDSMVGHNEEASGHN
GETKTPRPSSTRGSSGSRGGGGSSSSSSELSTPEKPPHQRAGPFSSRWETTTGEPSASIP
TTVGSLPSSKSFLGMKARELFRNKSESQCDEDGMTSSLSESLKTELSKDLGVEAKTPLNL
DGPHPSPPNPDSVGQLHIMDYNETHHEHS
NT seq 3510 nt   +upstreamnt  +downstreamnt
atggcccaacaagcgaatgtcggggagctcctcgccatgctggactccccgatgctgggt
gtgcgggacgacgtgacagctgtctttaaagagaacctcaattctgaccgtggtcctatg
cttgtaaacaccttggtggattattacctggaaaccaactctcagccggcgttgcacatc
ctgaccaccttacaagagccacatgacaagcacctcttggacaggattaatgaatatgtg
ggtaaagccgccactcgtttatccatcctctcgttactgggtcatgtcataagactgcag
ccatcttggaagcataagctgtctcaagcacctcttttgccttctttactaaaatgtctc
aagatggacactgacgtcgttgtcctcacaacaggcgtcttggtgttgataaccatgcta
ccaatgattccacagtctgggaaacagcatcttcttgatttctttgacatttttggccgt
ctttcatcatggtgtctgaagaaaccaggccacgtggcggaagtctatctcgtccatctc
catgccagtgtgtacgcactctttcatcgcctttatggaatgtacccttgcaactttgtc
tcctttttgcgttctcattacagtatgaaagaaaacctggagacttttgaagaagtggtc
aagccaatgatggagcatgtgcgaattcatccggaattagtgactggatccaaggaccat
gaactggaccctcgaaggtggaagagattagaaactcatgatgttgtgatcgagtgtgcc
aaaatctctctggatcccacagaagcctcatatgaagatggctattctgtgtctcaccaa
atctcagctcgctttcctcatcgttcagccgatgtcaccaccagcccttatgttgacaca
cagaatagctatgggtgtgctacttctaccccttactccacgtctcggctgatgttgtta
aatacgccagggcagctacctcagactctgagttccccatctacacggctgataactgaa
ccaccacaagtatggtgtcaattggctactctttggagcccatctatggtttgtggtatg
accactcctccaacttctcctggaaatgtcccacctgatctgtcacacccttacagtaaa
gtctttggtacaactgcaggtggaaaaggaactcctctgggaaccccagcaacctctcct
cctccagccccactctgtcattcggatgactacgtgcacatttcactcccccaggccaca
gccacaccccccaggaaggaagagagaatggattctgcaagaccatgtctacacagacag
caccatcttctgaatgatagaggatcagaagagccacctggcagcaaaggttctgtcact
ctaagtgatcttccagggtttttaggtgatctggcctctgaagaagatagtattgaaaaa
gataaagaagaagctgcaatatctagagaactttctgagatcaccacagcagaggctgag
cctgtggttcctcgaggaggctttgactctcccttttaccgagagagtctcccaggttct
cagcggaagacccactcggcagcctccagtgctcagggcgccagcgtgaaccctgagcct
ttacactcctccctggacaagcttgggcctgacacaccaaagcaagcctttactcccata
gacctgccctgcggcggtgctgaggaaagccctgcgggagacagggaatgccagacttct
ttggagaccagtatcctcactcccagtccttgtaaaattccaccttcgacaagagtgggc
tttggaagcgggcagcctcccccgtacgatcatctttttgaggtggcattgccaaagaca
gcccatcattttgtcatcgggaagactgaggagcttttaaagaaagcaaaaggaagcaca
gaggaagatggtgtgccctctacctccccaatggaagtgctggacagactgatacagcag
ggagcagacgcgcacagcaaggagctgaacaagttgcctttacccagcaagtctgtcgac
tggacccactttggaggctctcctccttcagatgagatccgcaccctccgagaccagttg
cttttactgcacaaccagttactctacgagcgttttaagaggcagcagcatgccctgcgg
aacaggcggctcctccgcaaggtgatcaaagcagcagctctggaggaacataatgctgcc
atgaaagatcagttgaagttacaagagaaagacatccagatgtggaaggttagtctgcag
aaagaacaagctagatacagtcagcttcaggagcagcgtgacactatggtgaccaagctc
cacagccagatcagacagctgcagcatgaccgagaggaattctacaaccagagccaggaa
ttacagacgaaactggaggactgcaggaacatgattgcagagctgcggatagaattgaag
aaggccaacaacaaggtgtgtcacactgagctgctgctcagtcaggtttcccaaaagctc
tcaaacagtgagtcggtccagcagcagatggagttcttgaacaggcagctgttggttctt
ggggaggtcaacgagctatatttggaacaactgcagaacaagcactcagataccacaaag
gaagtagaaatgatgaaagctgcctatcggaaagagctagaaaaaaacagaagccatgtt
ctccagcagactcagaggcttgacacctcccagaaacggattttggaactggaatctcac
ctggccaagaaagaccaccttcttttggaacagaagaaatatttagaggatgtcaaactc
caggcaagaggacagctgcaggctgcagagagcaggtatgaggctcagaaaaggataacc
caggtgtttgaattggagatcttagatttatatggcaggttggagaaagatggcctcctg
aaaaaacttgaagaagaaaaagccgaagcagctgaagcagcagaagaaaggcttgactgt
tgtaatgacgggtgctcagattccatggtagggcacaatgaagaggcatctggccacaac
ggtgagaccaagacccccaggcccagcagcacccggggcagtagtggaagcagaggaggt
ggaggcagcagcagcagcagcagcgagctttccaccccggagaagcccccacaccagagg
gcgggcccattcagcagtcggtgggagacgacgacgggagaaccgtctgccagcatccct
accactgtgggctcacttcccagttcaaaaagcttcctgggtatgaaggcccgagagtta
tttcgtaataagagcgagagtcagtgtgatgaggacggcatgaccagtagcctttctgag
agcctaaagacggaactgagcaaagacttgggtgtggaagccaagactcccctgaaccta
gatggcccgcacccatctcccccgaacccggacagtgttggacagctacatatcatggac
tacaatgagactcatcatgaacacagctaa

DBGET integrated database retrieval system