KEGG   Macaca mulatta (rhesus monkey): 715138Help
Entry
715138            CDS       T01028                                 

Gene name
TMPRSS2
Definition
(RefSeq) transmembrane protease, serine 2
  KO
K09633  transmembrane protease serine 2 [EC:3.4.21.-]
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc05164  Influenza A
mcc05202  Transcriptional misregulation in cancer
mcc05215  Prostate cancer
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09160 Human Diseases
  09161 Cancers: Overview
   05202 Transcriptional misregulation in cancer
    715138 (TMPRSS2)
  09162 Cancers: Specific types
   05215 Prostate cancer
    715138 (TMPRSS2)
  09172 Infectious diseases: Viral
   05164 Influenza A
    715138 (TMPRSS2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:mcc01002]
    715138 (TMPRSS2)
Enzymes [BR:mcc01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.-  
     715138 (TMPRSS2)
Peptidases [BR:mcc01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   715138 (TMPRSS2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Trypsin SRCR_2 Hepsin-SRCR SRCR DUF1986 Trypsin_2 Ldl_recept_a
Motif
Other DBs
NCBI-GeneID: 715138
NCBI-ProteinID: XP_014988331
Ensembl: ENSMMUG00000015332
UniProt: A0A1D5RIR7
LinkDB All DBs
Position
3
AA seq 492 aa AA seqDB search
MALNSGSPPGVGPYYENHGYQPENPYPAQPTVAPNVYEVHPAQYYPSPVPQYTPRVLTHA
SNPAVCRQPKSPSGTVCTSKTKKALCVTMTLGAVLVGAALAAGLLWKFMGSKCSDSGIEC
DSSGTCISSSNWCDGVSHCPNGEDENRCVRLYGPNFILQVYSSQRKSWHPVCRDDWNENY
ARAACRDMGYKNSFYSSQGIVDNSGATSFMKLNTSAGNVDIYKKLYHSDACSSKAVVSLR
CIACGVRSNLSRQSRIVGGQNALLGAWPWQVSLHVQNIHVCGGSIITPEWIVTAAHCVEK
PLNSPWQWTAFVGTLRQSSMFYEKGHRVEKVISHPNYDSKTKNNDIALMKLHTPLTFNEV
VKPVCLPNPGMMLEPEQHCWISGWGATQEKGKTSDVLNAAMVPLIEPRRCNNKYVYDGLI
TPAMICAGFLQGTVDSCQGDSGGPLVTLKNDVWWLIGDTSWGSGCAQANRPGVYGNVTVF
TDWIYRQMRADD
NT seq 1479 nt NT seq  +upstreamnt  +downstreamnt
atggctttgaactcagggtcaccgccaggtgttggaccttactacgaaaaccatggatac
caaccggaaaacccctatcctgcacagcccaccgtggcccccaatgtctacgaggtgcat
ccggctcagtactacccgtcccccgtaccccagtacaccccgagggtcctgacgcatgct
tccaaccccgccgtctgcaggcagcccaaatccccgtcggggacagtgtgcacctcaaag
actaagaaagcactgtgcgtcaccatgaccctgggggccgtcctcgtgggagctgcgctg
gccgctggcctgctctggaagttcatgggcagcaagtgctccgactctgggatagagtgc
gactcctcaggtacctgcatcagctcctctaactggtgcgatggcgtgtcacactgcccg
aacggggaggacgagaaccggtgtgttcgcctctatggaccaaacttcattcttcaggtg
tactcatctcagaggaagtcctggcaccctgtatgccgagacgactggaacgagaactac
gcgcgggcagcctgcagggacatgggctataagaatagtttttactctagccaaggaata
gtggataacagtggagccaccagctttatgaaactgaacacaagtgctggcaacgtcgat
atctataaaaaactgtaccacagtgacgcctgttcttcaaaagcagtggtttctttacgc
tgtatagcttgtggggtccgctcaaacttaagccgccagagcaggatcgtgggcggccag
aacgcgctcctgggggcctggccctggcaggtcagtctgcacgtccagaacatccatgtg
tgcggaggctccatcatcacccccgagtggatcgtgacagctgctcactgcgtggaaaaa
cctcttaacagtccgtggcaatggacggcatttgtggggactttgagacaatcttccatg
ttctatgaaaaaggacaccgagtagaaaaagtgatttctcatccaaattatgactccaag
accaagaacaatgacattgcgctgatgaagctgcatacgcctctgactttcaacgaggtg
gtgaaaccagtatgtctgcccaacccaggcatgatgctggagccggaacagcactgctgg
atttctgggtggggggccacccaggagaaagggaagacctcagacgtgctgaacgctgcc
atggtgcctctcattgagccgcggagatgcaacaacaaatacgtctacgacggcctgatc
acaccagccatgatctgtgccggcttcctgcaggggaccgttgattcttgccagggtgac
agtggagggcctctggtcactttgaagaacgatgtctggtggctgatcggggatacaagc
tggggatctggctgtgcccaagctaacagaccaggagtgtacggaaatgtgaccgtcttc
acggactggatttatcgacaaatgagggcagatgactaa

DBGET integrated database retrieval system