KEGG   Macaca mulatta (rhesus monkey): 715272
Entry
715272            CDS       T01028                                 

Gene name
RAPGEF1
Definition
(RefSeq) rap guanine nucleotide exchange factor 1 isoform X1
  KO
K06277  Rap guanine nucleotide exchange factor 1
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04015  Rap1 signaling pathway
mcc04510  Focal adhesion
mcc04722  Neurotrophin signaling pathway
mcc04910  Insulin signaling pathway
mcc05211  Renal cell carcinoma
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    715272 (RAPGEF1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    715272 (RAPGEF1)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    715272 (RAPGEF1)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    715272 (RAPGEF1)
 09160 Human Diseases
  09162 Cancer: specific types
   05211 Renal cell carcinoma
    715272 (RAPGEF1)
SSDB
Motif
Pfam: RasGEF RasGEF_N
Other DBs
NCBI-GeneID: 715272
NCBI-ProteinID: XP_014972006
Ensembl: ENSMMUG00000006479
LinkDB
Position
15
AA seq 1265 aa
MGNAIEKQKPLKRSHLYPWKQDSQRSHLSSFTMKLMDKFHSPKIKRTPSKKGKPAEVSVK
IPEKPVNKEATDRFLPEGYPLPLDLEQQAVEFMSTSAVASRSQRQKNLSWLEEKEKEVVS
ALRYFKTIVDKMAIDKKVLEMLPGSASKVLEAILPLVQNDPRIQHSSALSSCYSRVYQSL
ANLIRWSDQVMLEGVNSEDKEMVTTVKGVIKAVLDGVKELVRLTVEKQGRPSPTSPVKPS
SPAGKPDGPAELPLTDREVEILNKTTGMSQSTELLPDATDEEVAPPKPPLPGIRVVDNSP
PPALPPKKRQSAPSPTRVAVVAPMSRATSGSSLPVGINRQDFDVDCYAQRRLSGGSHSYG
GESPRLSPCSSIGKLSKSDEQLSSLDRDSGQCSRNTSCETLDHYDPDYEFLQQDLSNADQ
IPQQTAWNLSPLPESLGESGSPFVGHPFQLPLGSHPQPDGPLAPGQQTDTPPALPEKKRR
SAASQTADSSGCRVSYERHPSQYDNISGEDLQSTAPIQSVPYAPFAAILPFQHGGSSAPV
EFVGDFTAPESTGDPEKPPPLPEKKNKHMLAYMQLLEDYSEPQPSMFYQTPQNEHIYQQK
NKLLMEVYGFSDSFSGVDSVQELAPPPALPPKQRQLQASCAAASFSSVSYCVQQTKVAFT
PEDGSAAQGLSVSVSHSFLSRHGSLPVPSYKSVFRSYSQDFVPHHQASVPPFLPPTSSSS
PHFPPAHQAQSSDLAVPAMAGPPPSTVDGPLSASQESSFHGNTVCLPSETSFTDSSENAS
EEAGEGEYVSLYSSGQSSKELAPSRGEPPTGKDGHPRDPSAVSNVPGKDSRDGSERAPKS
PDALESAQSEEEVDELSLIDHNEIMSRLTLKQEGDDGPDVRGGSGDILLVHATETDRKDL
VLYCEAFLTTYRTFISPEELIKKLQYRYEKFSPFADTFKKRVSKNTFFVLVRVVDELCLV
ELTEEILKLLMELVFRLVCNGELSLARVLRKNILDKVDQKKLLRCATSGQPLAARGVAAR
PGTLHDFHSHEIAEQLTLLDAELFYKIEIPEVLLWAKEQNEEKSPNLTQFTEHFNNMSYW
VRSIIMLQEKAQDRERLLLKFIKIMKHLRKLNNFNSYLAILSALDSAPIRRLEWQKQTSE
GLAEYCTLIDSSSSFRAYRAALSEVEPPCIPYLGLILQDLTFVHLGNPDYIDGKVNFSKR
WQQFNILDSMRCFQQAHYDIRRNDDIINFFNDFSDHLAEEALWELSLKIKPRNITRRKTD
REEKT
NT seq 3798 nt   +upstreamnt  +downstreamnt
atgggcaatgctattgaaaaacagaagccgttgaaacgaagtcatctgtacccctggaaa
caagactctcagcgttctcatctctcttccttcaccatgaagctgatggacaaattccac
tcacccaaaatcaagagaacgccatcaaagaagggaaaaccagctgaggtgtccgtaaag
attccagagaaacctgtgaacaaagaggcaacagacagatttctaccagagggctaccct
ctccccttggatctggagcagcaggcagtagaatttatgtccaccagtgctgtggcttcc
aggtctcaaaggcagaagaacctgagctggctggaggagaaagagaaggaagtggtcagt
gccctgcgctactttaagaccattgtggacaaaatggcaattgataagaaggtactggag
atgcttccagggtcagccagcaaggtgctggaggccatcttacccctggtgcagaacgat
cctcgaattcagcacagctcagccctctcttcctgctatagccgagtgtaccaaagtctc
gccaacctcattcgctggtctgaccaagtgatgctggaaggtgtgaactcagaagacaag
gagatggtgacgactgtgaagggggtcatcaaggccgtgctggatggagtgaaggagctg
gtcaggctcaccgtcgagaagcagggacgtccatctccgacgagccccgtgaagcccagt
tcccctgctggcaagcctgatggcccagcagagctccccctgacagaccgcgaggtagaa
atcctaaacaagacgaccgggatgtcacagtcaactgagctcctcccagatgccacagat
gaagaggtcgcgccccccaaaccccctctgcctggcattcgggtggttgataatagtcct
ccaccagcattgccacccaagaaaagacagtcggcaccgtcccctacccgagtggctgtg
gtggcccccatgagccgagccaccagtggctccagtttgcctgttggaatcaataggcag
gattttgacgttgactgttatgcacagagacgactgtcaggaggcagccactcatatggt
ggagagtcgccccgcctctccccctgcagcagcataggcaagctcagcaagtcagacgag
cagctgtcctctctggacagggacagtgggcagtgctcccggaacacaagctgtgaaaca
ctagaccactatgatcccgactatgaattcctccagcaagacctctctaacgcagaccag
atacctcagcagacggcctggaaccttagcccgttgccagagtctttgggggagtctggg
tctccatttgttggccatcctttccagctgcctcttggcagccatccccagccagacgga
cctctggccccagggcagcagacagatacgccgcctgctctccccgagaagaagcgcagg
agtgcagcctcccagacggcggacagctctggctgcagggtgtcctacgagcggcatccc
tcgcagtacgacaacatctctggggaggacctgcagagcacggccccaatccagtccgtc
ccctatgcgccctttgctgctattctcccctttcagcatggaggttcctcagcccctgtc
gaatttgtgggtgattttactgctcctgaatcaacgggtgacccagaaaaaccacctcct
ctaccagagaagaaaaacaaacacatgctggcctacatgcagctgctggaggactactcg
gagccacagccctccatgttctaccagacgccgcagaacgagcacatctaccagcagaag
aacaagctcctcatggaggtatacggcttcagcgactccttcagcggggtggactccgtg
caggagctggccccgccgcccgccctaccccccaagcagcggcagctgcaggcctcctgt
gctgctgcttccttctcctctgtctcctactgtgtccagcaaactaaagtggccttcacc
cccgaggacggcagtgccgctcagggcctcagtgtgtccgtctctcactcctttctcagc
cggcacggcagcttgcctgtgccctcgtataagtctgtgtttaggtcctactcccaggat
ttcgtgcctcaccaccaagcttccgttccgcctttccttccgcctacctcctcttcctct
ccacatttcccacctgcccaccaggctcagagctctgacttagccgtgccagccatggcc
ggtccacctcccagcaccgtggacgggcctctctcggcttctcaggagagcagctttcat
gggaacactgtctgccttccttccgaaacctctttcactgactcgagtgaaaacgccagt
gaggaagctggtgagggtgaatatgtcagtctgtattcctctggccagagcagcaaggag
ctggctccctctcgaggagaaccaccgactgggaaagacggacatcccagagatccctca
gcagtcagcaacgtccctgggaaggacagcagagacggcagtgagagggccccaaagtca
ccagatgctctggagtcggctcagtcggaggaggaagtggacgagctgtccctcatcgac
cacaacgaaattatgtccaggctgacgctcaagcaggagggtgatgacgggccggatgtc
cgcggaggatctggggacatcttattggtccatgctactgagactgacaggaaagatttg
gtgttgtactgcgaggccttcctgaccacctacaggaccttcatctccccagaggagctc
atcaagaagctgcagtacagatacgagaaattctctccctttgctgacacattcaagaag
cgcgtcagcaagaacacattcttcgtactggtgcgggtggtggatgagctttgcctggtg
gaattgacagaagagatcctgaagctgctgatggaactggtcttccgcctggtgtgcaac
ggggagctgagcctggcccgcgtgctccgaaagaacatcctggacaaggtggaccagaag
aagctgctcaggtgtgccacctctggccagcccctggcggcccggggggtagcagccagg
ccggggaccttgcacgactttcacagccatgagatcgcagagcagctaactctgctggat
gctgagctcttctataaaatagagattcctgaggttttgctttgggcaaaagagcagaat
gaggaaaagagccccaacttgacccagttcacggagcacttcaacaacatgtcctactgg
gtccggtccataatcatgttacaggaaaaggcccaggacagggaacggctgctcttaaag
ttcatcaagatcatgaagcacttgcggaagctgaataacttcaactcctacttggccatc
ctctctgccctggactcagcgcccatccgcaggctggagtggcagaagcagacctcagag
ggcctggccgagtactgcacgctgattgacagctcatcctccttccgagcctaccgggcc
gccctctcggaggtggaaccaccgtgcatcccgtacctggggctgatcctgcaggacctg
accttcgttcacctgggaaacccagactacatcgatgggaaagtgaacttctccaagcgg
tggcagcagttcaacatcctcgacagcatgcggtgcttccagcaagcgcactatgacatc
cggaggaacgacgacattataaacttcttcaatgacttcagtgaccacctggctgaggag
gccctatgggaactctctctgaaaattaaacccaggaacataacaaggagaaaaacagac
cgggaagagaagacctag

DBGET integrated database retrieval system