KEGG   Macaca mulatta (rhesus monkey): 715335
Entry
715335            CDS       T01028                                 

Gene name
IRF9
Definition
(RefSeq) interferon regulatory factor 9
  KO
K04693  interferon regulatory factor 9
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04217  Necroptosis
mcc04380  Osteoclast differentiation
mcc04621  NOD-like receptor signaling pathway
mcc04625  C-type lectin receptor signaling pathway
mcc04630  JAK-STAT signaling pathway
mcc05160  Hepatitis C
mcc05162  Measles
mcc05164  Influenza A
mcc05165  Human papillomavirus infection
mcc05167  Kaposi sarcoma-associated herpesvirus infection
mcc05168  Herpes simplex virus 1 infection
mcc05169  Epstein-Barr virus infection
mcc05171  Coronavirus disease - COVID-19
mcc05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    715335 (IRF9)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    715335 (IRF9)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    715335 (IRF9)
   04625 C-type lectin receptor signaling pathway
    715335 (IRF9)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    715335 (IRF9)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    715335 (IRF9)
  09172 Infectious disease: viral
   05160 Hepatitis C
    715335 (IRF9)
   05171 Coronavirus disease - COVID-19
    715335 (IRF9)
   05164 Influenza A
    715335 (IRF9)
   05162 Measles
    715335 (IRF9)
   05168 Herpes simplex virus 1 infection
    715335 (IRF9)
   05167 Kaposi sarcoma-associated herpesvirus infection
    715335 (IRF9)
   05169 Epstein-Barr virus infection
    715335 (IRF9)
   05165 Human papillomavirus infection
    715335 (IRF9)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mcc03000]
    715335 (IRF9)
Transcription factors [BR:mcc03000]
 Eukaryotic type
  Helix-turn-helix
   Tryptophan clusters interferon-regulating factors
    715335 (IRF9)
SSDB
Motif
Pfam: IRF-3 IRF
Other DBs
NCBI-GeneID: 715335
NCBI-ProteinID: NP_001247598
Ensembl: ENSMMUG00000040817
UniProt: G7MX63 H9Z496
LinkDB
Position
7
AA seq 392 aa
MASGRARCTRKLRNWVVEQVESGQFPGVCWDDTAKTMFRIPWKHAGKQDFREDQDAAFFK
AWAIFKGKYKEGDTGGPAVWKTRLRCALNKSTEFEEVPNRGRMDVAEPYKVYRLLPPGTF
SGQPGTQKSPSKRQHSSVSSERKEEEGAMQNCTLSPSVLQESLNNEEEEASGGALHSDIG
SSSSSSPEPQEGTDTTEAPFQGDQRSLEFLLPPEPDYSLLLTFIYNGRVVGEAQVQSLDC
RLVAEPSGSESSMEQVLFPKPGPLEPTQRLLSQLERGILVASNPRGLFVQRLCPIPIFWN
APQAPPGPGPHLLPSNECVELFRTAYFCRDLAKYFQGLGPPPKFQVTLNFWEESRGPSHT
PQNLITVKMEQAFARYLLEETPEQQAAILSLV
NT seq 1179 nt   +upstreamnt  +downstreamnt
atggcatcaggcagggcacgctgtacccgaaaactccggaactgggtggtggagcaagtg
gagagcgggcagttccccggagtgtgctgggatgatacagctaagaccatgttccggatt
ccctggaagcatgcaggcaagcaggacttccgagaggaccaggatgctgccttcttcaag
gcctgggcaatatttaagggaaagtataaggaaggggacacaggaggccccgctgtctgg
aagactcgcctgcgctgtgcactcaacaagagtaccgaatttgaggaggttcctaacagg
ggccgcatggatgttgctgagccctacaaggtgtatcggctgctgccaccaggaaccttc
tctggccagccagggactcagaaatcaccatcaaagcgacagcacagttctgtgtcctct
gagaggaaggaggaagagggtgccatgcagaactgcacactcagtccctctgtactccag
gaatccctcaataatgaggaggaggaggccagtgggggagcactccattcagacatcggg
agcagcagcagcagcagccctgagccacaggaaggtacagacacaactgaggcccccttt
caaggggatcagaggtccctggagtttctgcttcctccagagccagactactcactgctg
ctcaccttcatctacaacgggcgtgtggtgggcgaggcccaggtgcaaagcctggattgc
cgccttgtggctgagccctcaggctctgagagcagcatggagcaggtgctgttccccaag
cctggcccactggagcccacgcagcgcctgctgagccagcttgagaggggcatcctggtg
gccagcaacccccgaggcctcttcgtgcagcgcctttgccccatccccatcttctggaat
gcaccccaggctccacctgggccaggcccacatctgctgcccagcaacgagtgtgtggag
ctcttcagaaccgcctacttctgcagagacttggccaagtacttccagggcctaggcccc
ccaccgaagttccaagtaacactgaatttctgggaagagagccgtggccccagccatact
ccacagaatcttatcacagtgaagatggagcaggcctttgcccgatacttgctggaggag
actccagagcagcaggcagccattctgtccctggtgtag

DBGET integrated database retrieval system