KEGG   Macaca mulatta (rhesus monkey): 715378
Entry
715378            CDS       T01028                                 

Gene name
RHEB
Definition
(RefSeq) GTP-binding protein Rheb
  KO
K07208  Ras homolog enriched in brain
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04072  Phospholipase D signaling pathway
mcc04140  Autophagy - animal
mcc04150  mTOR signaling pathway
mcc04151  PI3K-Akt signaling pathway
mcc04152  AMPK signaling pathway
mcc04211  Longevity regulating pathway
mcc04218  Cellular senescence
mcc04714  Thermogenesis
mcc04910  Insulin signaling pathway
mcc04919  Thyroid hormone signaling pathway
mcc05163  Human cytomegalovirus infection
mcc05165  Human papillomavirus infection
mcc05168  Herpes simplex virus 1 infection
mcc05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04072 Phospholipase D signaling pathway
    715378 (RHEB)
   04151 PI3K-Akt signaling pathway
    715378 (RHEB)
   04152 AMPK signaling pathway
    715378 (RHEB)
   04150 mTOR signaling pathway
    715378 (RHEB)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    715378 (RHEB)
  09143 Cell growth and death
   04218 Cellular senescence
    715378 (RHEB)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    715378 (RHEB)
   04919 Thyroid hormone signaling pathway
    715378 (RHEB)
  09149 Aging
   04211 Longevity regulating pathway
    715378 (RHEB)
  09159 Environmental adaptation
   04714 Thermogenesis
    715378 (RHEB)
 09160 Human Diseases
  09161 Cancer: overview
   05231 Choline metabolism in cancer
    715378 (RHEB)
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    715378 (RHEB)
   05163 Human cytomegalovirus infection
    715378 (RHEB)
   05165 Human papillomavirus infection
    715378 (RHEB)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04031 GTP-binding proteins [BR:mcc04031]
    715378 (RHEB)
GTP-binding proteins [BR:mcc04031]
 Small (monomeric) G-proteins
  Ras Family
   Rheb
    715378 (RHEB)
SSDB
Motif
Pfam: Ras Roc Arf MMR_HSR1 GTP_EFTU RsgA_GTPase SRPRB
Other DBs
NCBI-GeneID: 715378
NCBI-ProteinID: NP_001248111
UniProt: F7H5C5
LinkDB
Position
3
AA seq 184 aa
MPQSKSRKIAILGYRSVGKSSLTIQFVEGQFVDSYDPTIENTFTKLITVNGQEYHLQLVD
TAGQDEYSIFPQTYSIDINGYILVYSVTSIKSFEVIKVIHGKLLDMVGKVQIPIMLVGNK
KDLHMERVISYEEGKALAESWNAAFLESSAKENQTAVDVFRRIILEAEKMDGAASQGKSS
CSVM
NT seq 555 nt   +upstreamnt  +downstreamnt
atgccgcagtccaagtcccggaagatcgcgatcctgggctaccggtctgtggggaaatcc
tcattgacgattcaatttgttgaaggccaatttgtggactcctacgatccaaccatagaa
aacacttttacaaagttgatcacagtaaatggacaagaatatcatcttcaacttgtagac
acagctgggcaagatgaatattctatctttcctcagacctactccatagatattaatggc
tatattcttgtgtattctgttacatcaatcaaaagttttgaagtgattaaagttatccat
gggaaattattggatatggtggggaaagtacaaatacctattatgttggttgggaataag
aaagacctgcatatggaaagggtgatcagttatgaagaagggaaagctttggcagaatct
tggaatgcagcttttttggaatcttctgctaaagaaaatcagactgctgttgatgttttt
agaaggataattttggaggcagaaaaaatggatggggcagcttcacaaggcaagtcttca
tgctcggtgatgtga

DBGET integrated database retrieval system