KEGG   Macaca mulatta (rhesus monkey): 715467
Entry
715467            CDS       T01028                                 

Gene name
TNF
Definition
(RefSeq) tumor necrosis factor
  KO
K03156  tumor necrosis factor superfamily, member 2
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc01523  Antifolate resistance
mcc04010  MAPK signaling pathway
mcc04060  Cytokine-cytokine receptor interaction
mcc04061  Viral protein interaction with cytokine and cytokine receptor
mcc04064  NF-kappa B signaling pathway
mcc04071  Sphingolipid signaling pathway
mcc04150  mTOR signaling pathway
mcc04210  Apoptosis
mcc04217  Necroptosis
mcc04350  TGF-beta signaling pathway
mcc04380  Osteoclast differentiation
mcc04612  Antigen processing and presentation
mcc04620  Toll-like receptor signaling pathway
mcc04621  NOD-like receptor signaling pathway
mcc04622  RIG-I-like receptor signaling pathway
mcc04625  C-type lectin receptor signaling pathway
mcc04640  Hematopoietic cell lineage
mcc04650  Natural killer cell mediated cytotoxicity
mcc04657  IL-17 signaling pathway
mcc04660  T cell receptor signaling pathway
mcc04664  Fc epsilon RI signaling pathway
mcc04668  TNF signaling pathway
mcc04920  Adipocytokine signaling pathway
mcc04930  Type II diabetes mellitus
mcc04931  Insulin resistance
mcc04932  Non-alcoholic fatty liver disease
mcc04933  AGE-RAGE signaling pathway in diabetic complications
mcc04940  Type I diabetes mellitus
mcc05010  Alzheimer disease
mcc05014  Amyotrophic lateral sclerosis
mcc05020  Prion disease
mcc05022  Pathways of neurodegeneration - multiple diseases
mcc05132  Salmonella infection
mcc05133  Pertussis
mcc05134  Legionellosis
mcc05135  Yersinia infection
mcc05140  Leishmaniasis
mcc05142  Chagas disease
mcc05143  African trypanosomiasis
mcc05144  Malaria
mcc05145  Toxoplasmosis
mcc05146  Amoebiasis
mcc05152  Tuberculosis
mcc05160  Hepatitis C
mcc05161  Hepatitis B
mcc05163  Human cytomegalovirus infection
mcc05164  Influenza A
mcc05165  Human papillomavirus infection
mcc05166  Human T-cell leukemia virus 1 infection
mcc05168  Herpes simplex virus 1 infection
mcc05169  Epstein-Barr virus infection
mcc05170  Human immunodeficiency virus 1 infection
mcc05171  Coronavirus disease - COVID-19
mcc05205  Proteoglycans in cancer
mcc05310  Asthma
mcc05321  Inflammatory bowel disease
mcc05322  Systemic lupus erythematosus
mcc05323  Rheumatoid arthritis
mcc05330  Allograft rejection
mcc05332  Graft-versus-host disease
mcc05410  Hypertrophic cardiomyopathy
mcc05414  Dilated cardiomyopathy
mcc05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    715467 (TNF)
   04350 TGF-beta signaling pathway
    715467 (TNF)
   04064 NF-kappa B signaling pathway
    715467 (TNF)
   04668 TNF signaling pathway
    715467 (TNF)
   04071 Sphingolipid signaling pathway
    715467 (TNF)
   04150 mTOR signaling pathway
    715467 (TNF)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    715467 (TNF)
   04061 Viral protein interaction with cytokine and cytokine receptor
    715467 (TNF)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    715467 (TNF)
   04217 Necroptosis
    715467 (TNF)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    715467 (TNF)
   04620 Toll-like receptor signaling pathway
    715467 (TNF)
   04621 NOD-like receptor signaling pathway
    715467 (TNF)
   04622 RIG-I-like receptor signaling pathway
    715467 (TNF)
   04625 C-type lectin receptor signaling pathway
    715467 (TNF)
   04650 Natural killer cell mediated cytotoxicity
    715467 (TNF)
   04612 Antigen processing and presentation
    715467 (TNF)
   04660 T cell receptor signaling pathway
    715467 (TNF)
   04657 IL-17 signaling pathway
    715467 (TNF)
   04664 Fc epsilon RI signaling pathway
    715467 (TNF)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    715467 (TNF)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    715467 (TNF)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    715467 (TNF)
  09163 Immune disease
   05310 Asthma
    715467 (TNF)
   05322 Systemic lupus erythematosus
    715467 (TNF)
   05323 Rheumatoid arthritis
    715467 (TNF)
   05321 Inflammatory bowel disease
    715467 (TNF)
   05330 Allograft rejection
    715467 (TNF)
   05332 Graft-versus-host disease
    715467 (TNF)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    715467 (TNF)
   05014 Amyotrophic lateral sclerosis
    715467 (TNF)
   05020 Prion disease
    715467 (TNF)
   05022 Pathways of neurodegeneration - multiple diseases
    715467 (TNF)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    715467 (TNF)
   05410 Hypertrophic cardiomyopathy
    715467 (TNF)
   05414 Dilated cardiomyopathy
    715467 (TNF)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    715467 (TNF)
   04940 Type I diabetes mellitus
    715467 (TNF)
   04932 Non-alcoholic fatty liver disease
    715467 (TNF)
   04931 Insulin resistance
    715467 (TNF)
   04933 AGE-RAGE signaling pathway in diabetic complications
    715467 (TNF)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    715467 (TNF)
   05135 Yersinia infection
    715467 (TNF)
   05133 Pertussis
    715467 (TNF)
   05134 Legionellosis
    715467 (TNF)
   05152 Tuberculosis
    715467 (TNF)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    715467 (TNF)
   05170 Human immunodeficiency virus 1 infection
    715467 (TNF)
   05161 Hepatitis B
    715467 (TNF)
   05160 Hepatitis C
    715467 (TNF)
   05171 Coronavirus disease - COVID-19
    715467 (TNF)
   05164 Influenza A
    715467 (TNF)
   05168 Herpes simplex virus 1 infection
    715467 (TNF)
   05163 Human cytomegalovirus infection
    715467 (TNF)
   05169 Epstein-Barr virus infection
    715467 (TNF)
   05165 Human papillomavirus infection
    715467 (TNF)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    715467 (TNF)
   05144 Malaria
    715467 (TNF)
   05145 Toxoplasmosis
    715467 (TNF)
   05140 Leishmaniasis
    715467 (TNF)
   05142 Chagas disease
    715467 (TNF)
   05143 African trypanosomiasis
    715467 (TNF)
  09176 Drug resistance: antineoplastic
   01523 Antifolate resistance
    715467 (TNF)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mcc04052]
    715467 (TNF)
   00536 Glycosaminoglycan binding proteins [BR:mcc00536]
    715467 (TNF)
Cytokines and growth factors [BR:mcc04052]
 Cytokines
  Tumor necrosis fators
   715467 (TNF)
Glycosaminoglycan binding proteins [BR:mcc00536]
 Heparan sulfate / Heparin
  Cytokines
   715467 (TNF)
SSDB
Motif
Pfam: TNF
Other DBs
NCBI-GeneID: 715467
NCBI-ProteinID: NP_001040614
Ensembl: ENSMMUG00000045654
UniProt: P48094 G7MRI3 A0A0U5J6L8
LinkDB
Position
4
AA seq 233 aa
MSTESMIRDVELAEEALPRKTAGPQGSRRCWFLSLFSFLLVAGATTLFCLLHFGVIGPQR
EEFPKDPSLISPLAQAVRSSSRTPSDKPVAHVVANPQAEGQLQWLNRRANALLANGVELT
DNQLVVPSEGLYLIYSQVLFKGQGCPSNHVLLTHTISRIAVSYQTKVNLLSAIKSPCQRE
TPEGAEAKPWYEPIYLGGVFQLEKGDRLSAEINLPDYLDFAESGQVYFGIIAL
NT seq 702 nt   +upstreamnt  +downstreamnt
atgagcactgaaagcatgatccgggacgtggagctggccgaggaggcgctcccaaggaag
acagcggggccccagggctccaggcggtgctggttcctcagcctcttctccttcctgctc
gtggcaggcgccaccacgctcttctgtctgctgcactttggagtgatcggcccccagagg
gaagagttccccaaggacccctctctaatcagccctctggctcaggcagtcagatcatct
tctcgaaccccaagtgacaagcctgtagcccatgttgtagcaaaccctcaagctgagggg
cagctccagtggctgaaccgccgggccaatgccctcctggccaatggcgtggagctgaca
gataaccagctggtggtgccatcagaaggcctgtacctcatctactcccaggtcctcttc
aagggccaaggctgcccctccaaccatgtgctcctcacccacaccatcagccgcatcgcc
gtctcctaccagaccaaggtcaacctcctctctgccatcaagagcccctgccagagggag
actccagagggggctgaggccaagccctggtatgagcccatctacctaggaggggtcttt
cagctggagaagggtgatcgactcagcgctgagatcaatctgcccgactatctcgacttt
gccgagtctgggcaggtctactttgggatcattgccctgtga

DBGET integrated database retrieval system