KEGG   Macaca mulatta (rhesus monkey): 715745
Entry
715745            CDS       T01028                                 

Gene name
MAPK12
Definition
(RefSeq) mitogen-activated protein kinase 12 isoform X1
  KO
K04441  p38 MAP kinase [EC:2.7.11.24]
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc01522  Endocrine resistance
mcc04010  MAPK signaling pathway
mcc04015  Rap1 signaling pathway
mcc04068  FoxO signaling pathway
mcc04071  Sphingolipid signaling pathway
mcc04114  Oocyte meiosis
mcc04218  Cellular senescence
mcc04261  Adrenergic signaling in cardiomyocytes
mcc04370  VEGF signaling pathway
mcc04380  Osteoclast differentiation
mcc04550  Signaling pathways regulating pluripotency of stem cells
mcc04611  Platelet activation
mcc04620  Toll-like receptor signaling pathway
mcc04621  NOD-like receptor signaling pathway
mcc04622  RIG-I-like receptor signaling pathway
mcc04625  C-type lectin receptor signaling pathway
mcc04657  IL-17 signaling pathway
mcc04658  Th1 and Th2 cell differentiation
mcc04659  Th17 cell differentiation
mcc04660  T cell receptor signaling pathway
mcc04664  Fc epsilon RI signaling pathway
mcc04668  TNF signaling pathway
mcc04670  Leukocyte transendothelial migration
mcc04714  Thermogenesis
mcc04722  Neurotrophin signaling pathway
mcc04723  Retrograde endocannabinoid signaling
mcc04728  Dopaminergic synapse
mcc04750  Inflammatory mediator regulation of TRP channels
mcc04912  GnRH signaling pathway
mcc04914  Progesterone-mediated oocyte maturation
mcc04917  Prolactin signaling pathway
mcc04926  Relaxin signaling pathway
mcc04933  AGE-RAGE signaling pathway in diabetic complications
mcc04935  Growth hormone synthesis, secretion and action
mcc05014  Amyotrophic lateral sclerosis
mcc05020  Prion disease
mcc05022  Pathways of neurodegeneration - multiple diseases
mcc05132  Salmonella infection
mcc05133  Pertussis
mcc05135  Yersinia infection
mcc05140  Leishmaniasis
mcc05142  Chagas disease
mcc05145  Toxoplasmosis
mcc05152  Tuberculosis
mcc05161  Hepatitis B
mcc05163  Human cytomegalovirus infection
mcc05167  Kaposi sarcoma-associated herpesvirus infection
mcc05169  Epstein-Barr virus infection
mcc05170  Human immunodeficiency virus 1 infection
mcc05171  Coronavirus disease - COVID-19
mcc05205  Proteoglycans in cancer
mcc05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
mcc05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    715745 (MAPK12)
   04015 Rap1 signaling pathway
    715745 (MAPK12)
   04370 VEGF signaling pathway
    715745 (MAPK12)
   04668 TNF signaling pathway
    715745 (MAPK12)
   04068 FoxO signaling pathway
    715745 (MAPK12)
   04071 Sphingolipid signaling pathway
    715745 (MAPK12)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    715745 (MAPK12)
   04218 Cellular senescence
    715745 (MAPK12)
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    715745 (MAPK12)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    715745 (MAPK12)
   04620 Toll-like receptor signaling pathway
    715745 (MAPK12)
   04621 NOD-like receptor signaling pathway
    715745 (MAPK12)
   04622 RIG-I-like receptor signaling pathway
    715745 (MAPK12)
   04625 C-type lectin receptor signaling pathway
    715745 (MAPK12)
   04660 T cell receptor signaling pathway
    715745 (MAPK12)
   04658 Th1 and Th2 cell differentiation
    715745 (MAPK12)
   04659 Th17 cell differentiation
    715745 (MAPK12)
   04657 IL-17 signaling pathway
    715745 (MAPK12)
   04664 Fc epsilon RI signaling pathway
    715745 (MAPK12)
   04670 Leukocyte transendothelial migration
    715745 (MAPK12)
  09152 Endocrine system
   04912 GnRH signaling pathway
    715745 (MAPK12)
   04914 Progesterone-mediated oocyte maturation
    715745 (MAPK12)
   04917 Prolactin signaling pathway
    715745 (MAPK12)
   04926 Relaxin signaling pathway
    715745 (MAPK12)
   04935 Growth hormone synthesis, secretion and action
    715745 (MAPK12)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    715745 (MAPK12)
  09156 Nervous system
   04728 Dopaminergic synapse
    715745 (MAPK12)
   04723 Retrograde endocannabinoid signaling
    715745 (MAPK12)
   04722 Neurotrophin signaling pathway
    715745 (MAPK12)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    715745 (MAPK12)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    715745 (MAPK12)
  09159 Environmental adaptation
   04714 Thermogenesis
    715745 (MAPK12)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    715745 (MAPK12)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    715745 (MAPK12)
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    715745 (MAPK12)
   05020 Prion disease
    715745 (MAPK12)
   05022 Pathways of neurodegeneration - multiple diseases
    715745 (MAPK12)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    715745 (MAPK12)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    715745 (MAPK12)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    715745 (MAPK12)
   05135 Yersinia infection
    715745 (MAPK12)
   05133 Pertussis
    715745 (MAPK12)
   05152 Tuberculosis
    715745 (MAPK12)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    715745 (MAPK12)
   05161 Hepatitis B
    715745 (MAPK12)
   05171 Coronavirus disease - COVID-19
    715745 (MAPK12)
   05163 Human cytomegalovirus infection
    715745 (MAPK12)
   05167 Kaposi sarcoma-associated herpesvirus infection
    715745 (MAPK12)
   05169 Epstein-Barr virus infection
    715745 (MAPK12)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    715745 (MAPK12)
   05140 Leishmaniasis
    715745 (MAPK12)
   05142 Chagas disease
    715745 (MAPK12)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    715745 (MAPK12)
Enzymes [BR:mcc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     715745 (MAPK12)
Protein kinases [BR:mcc01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   715745 (MAPK12)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr
Other DBs
NCBI-GeneID: 715745
NCBI-ProteinID: XP_001112396
Ensembl: ENSMMUG00000014106
LinkDB
Position
10
AA seq 390 aa
MSSPPPARSGFYRQEVTKTAWEVRAVYRDLQPVGSGAYGAVCSAVDSHTGAKVAIKKLYR
PFQSELFAKRAYRELRLLKHMRHENVIGLLDVFTPDETLDDFTDFYLVMPFMGTDLGKLM
KHEKLGEDRIQFLVYQMLKGLRYIHAAGIIHRVSPGGGATHQPSPSAIPRLHVLPDLKPG
NLAVNEDCELKILDFGLARQADSEMTGYVVTRWYRAPEVILNWMRYTQTVDIWSVGCIMA
EMITGKTLFKGSDHLDQLKEIMKVTGTPPAEFVQRLQSDEAKNYMKGLPELEKKDFASIL
TNASPLAVNLLEKMLVLDAEQRVTAAEALAHPYFESLHDTEDEPQVQKYDDSFDDVDRTL
DEWKRVTYKEVLSFKPPRQLGARVSKETAL
NT seq 1173 nt   +upstreamnt  +downstreamnt
atgagctctccgccgcctgcccgcagtggcttttaccgccaggaggtgactaagacggcc
tgggaggtgcgcgccgtgtaccgggacctgcagcccgtgggctcgggcgcctatggcgcg
gtgtgctcggccgtggacagccacaccggcgctaaggtggccatcaagaagctgtaccgg
cccttccagtcggagctgttcgccaagcgcgcctaccgcgagctgcgcctgctcaagcac
atgcgccacgagaacgtgattgggctgctggatgtgttcactcctgatgagaccctggat
gacttcacagacttttacctggtgatgccattcatgggcaccgacctgggcaagctcatg
aaacatgagaagctgggcgaggaccggatccagttcctcgtgtaccagatgctgaagggg
ctgaggtatatccatgctgccggcatcatccacagagtgagtcctggtggaggagccacc
catcagccctcccccagcgcaatcccccgcctccacgtcctacctgacctgaagcctggc
aacctggctgtgaacgaagactgtgagctgaagatcctggactttggcctggccaggcag
gcagacagcgagatgactggctatgtggtgacccggtggtaccgggcacccgaggtcatc
ttgaattggatgcgctacacgcagacggtggacatctggtctgtggggtgcatcatggcg
gagatgatcacaggcaagacgctgttcaaaggcagcgaccacctggaccagctgaaggag
atcatgaaagtgacagggacgcctccagctgagtttgtgcagcggctgcagagtgatgag
gccaagaactacatgaagggcctccctgagttggagaagaaggattttgcctccatcctg
accaatgcaagccctctagctgtgaacctcctggagaagatgctggtgctggatgcggag
cagcgggtgacggcagccgaggcactggcccatccctacttcgagtccctgcacgacacg
gaagatgagccccaggtccagaagtatgacgactcctttgatgacgtggaccgcacgctg
gatgaatggaagcgtgttacttacaaagaggtgctcagcttcaagcctccccggcagctg
ggagccagggtctccaaggagacggctctgtga

KEGG   Macaca mulatta (rhesus monkey): 715794
Entry
715794            CDS       T01028                                 

Gene name
MAPK11
Definition
(RefSeq) mitogen-activated protein kinase 11
  KO
K04441  p38 MAP kinase [EC:2.7.11.24]
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc01522  Endocrine resistance
mcc04010  MAPK signaling pathway
mcc04015  Rap1 signaling pathway
mcc04068  FoxO signaling pathway
mcc04071  Sphingolipid signaling pathway
mcc04114  Oocyte meiosis
mcc04218  Cellular senescence
mcc04261  Adrenergic signaling in cardiomyocytes
mcc04370  VEGF signaling pathway
mcc04380  Osteoclast differentiation
mcc04550  Signaling pathways regulating pluripotency of stem cells
mcc04611  Platelet activation
mcc04620  Toll-like receptor signaling pathway
mcc04621  NOD-like receptor signaling pathway
mcc04622  RIG-I-like receptor signaling pathway
mcc04625  C-type lectin receptor signaling pathway
mcc04657  IL-17 signaling pathway
mcc04658  Th1 and Th2 cell differentiation
mcc04659  Th17 cell differentiation
mcc04660  T cell receptor signaling pathway
mcc04664  Fc epsilon RI signaling pathway
mcc04668  TNF signaling pathway
mcc04670  Leukocyte transendothelial migration
mcc04714  Thermogenesis
mcc04722  Neurotrophin signaling pathway
mcc04723  Retrograde endocannabinoid signaling
mcc04728  Dopaminergic synapse
mcc04750  Inflammatory mediator regulation of TRP channels
mcc04912  GnRH signaling pathway
mcc04914  Progesterone-mediated oocyte maturation
mcc04917  Prolactin signaling pathway
mcc04926  Relaxin signaling pathway
mcc04933  AGE-RAGE signaling pathway in diabetic complications
mcc04935  Growth hormone synthesis, secretion and action
mcc05014  Amyotrophic lateral sclerosis
mcc05020  Prion disease
mcc05022  Pathways of neurodegeneration - multiple diseases
mcc05132  Salmonella infection
mcc05133  Pertussis
mcc05135  Yersinia infection
mcc05140  Leishmaniasis
mcc05142  Chagas disease
mcc05145  Toxoplasmosis
mcc05152  Tuberculosis
mcc05161  Hepatitis B
mcc05163  Human cytomegalovirus infection
mcc05167  Kaposi sarcoma-associated herpesvirus infection
mcc05169  Epstein-Barr virus infection
mcc05170  Human immunodeficiency virus 1 infection
mcc05171  Coronavirus disease - COVID-19
mcc05205  Proteoglycans in cancer
mcc05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
mcc05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    715794 (MAPK11)
   04015 Rap1 signaling pathway
    715794 (MAPK11)
   04370 VEGF signaling pathway
    715794 (MAPK11)
   04668 TNF signaling pathway
    715794 (MAPK11)
   04068 FoxO signaling pathway
    715794 (MAPK11)
   04071 Sphingolipid signaling pathway
    715794 (MAPK11)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    715794 (MAPK11)
   04218 Cellular senescence
    715794 (MAPK11)
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    715794 (MAPK11)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    715794 (MAPK11)
   04620 Toll-like receptor signaling pathway
    715794 (MAPK11)
   04621 NOD-like receptor signaling pathway
    715794 (MAPK11)
   04622 RIG-I-like receptor signaling pathway
    715794 (MAPK11)
   04625 C-type lectin receptor signaling pathway
    715794 (MAPK11)
   04660 T cell receptor signaling pathway
    715794 (MAPK11)
   04658 Th1 and Th2 cell differentiation
    715794 (MAPK11)
   04659 Th17 cell differentiation
    715794 (MAPK11)
   04657 IL-17 signaling pathway
    715794 (MAPK11)
   04664 Fc epsilon RI signaling pathway
    715794 (MAPK11)
   04670 Leukocyte transendothelial migration
    715794 (MAPK11)
  09152 Endocrine system
   04912 GnRH signaling pathway
    715794 (MAPK11)
   04914 Progesterone-mediated oocyte maturation
    715794 (MAPK11)
   04917 Prolactin signaling pathway
    715794 (MAPK11)
   04926 Relaxin signaling pathway
    715794 (MAPK11)
   04935 Growth hormone synthesis, secretion and action
    715794 (MAPK11)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    715794 (MAPK11)
  09156 Nervous system
   04728 Dopaminergic synapse
    715794 (MAPK11)
   04723 Retrograde endocannabinoid signaling
    715794 (MAPK11)
   04722 Neurotrophin signaling pathway
    715794 (MAPK11)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    715794 (MAPK11)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    715794 (MAPK11)
  09159 Environmental adaptation
   04714 Thermogenesis
    715794 (MAPK11)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    715794 (MAPK11)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    715794 (MAPK11)
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    715794 (MAPK11)
   05020 Prion disease
    715794 (MAPK11)
   05022 Pathways of neurodegeneration - multiple diseases
    715794 (MAPK11)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    715794 (MAPK11)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    715794 (MAPK11)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    715794 (MAPK11)
   05135 Yersinia infection
    715794 (MAPK11)
   05133 Pertussis
    715794 (MAPK11)
   05152 Tuberculosis
    715794 (MAPK11)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    715794 (MAPK11)
   05161 Hepatitis B
    715794 (MAPK11)
   05171 Coronavirus disease - COVID-19
    715794 (MAPK11)
   05163 Human cytomegalovirus infection
    715794 (MAPK11)
   05167 Kaposi sarcoma-associated herpesvirus infection
    715794 (MAPK11)
   05169 Epstein-Barr virus infection
    715794 (MAPK11)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    715794 (MAPK11)
   05140 Leishmaniasis
    715794 (MAPK11)
   05142 Chagas disease
    715794 (MAPK11)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    715794 (MAPK11)
Enzymes [BR:mcc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     715794 (MAPK11)
Protein kinases [BR:mcc01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   715794 (MAPK11)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kdo APH RIO1 Cas_CT1975 Kinase-like
Other DBs
NCBI-GeneID: 715794
NCBI-ProteinID: XP_001112524
Ensembl: ENSMMUG00000014107
UniProt: F7C798
LinkDB
Position
10
AA seq 364 aa
MSGPRAGFYRQELNKTVWEVPQRLQGLRPVGSGAYGSVCSAYDARLRQKVAVKKLSRPFQ
SLIHARRTYRELRLLKHLKHENVIGLLDVFTPATSIEDFSEVYLVTTLMGADLNNIVKCQ
ALSDEHVQFLVYQLLRGLKYIHSAGIIHRDLKPSNVAVNEDCELRILDFGLARQADEEMT
GYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLQGKALFPGSDYIDQLKRIMEVVG
TPSPEVLAKISSEHARTYIQSLPPMPQKDLSSIFHGANPLAIDLLGRMLVLDSDQRVSAA
EALAHAYFSQYHDPEDEPEAEPYDESVEAKERTLEEWKELTYQEVLSFKPPEPPKPPGSL
EIEQ
NT seq 1095 nt   +upstreamnt  +downstreamnt
atgtcgggccctcgcgccggcttctaccggcaggagctgaacaagaccgtgtgggaggtg
ccgcagcggctgcaggggctgcgcccggtgggctcgggcgcctacggctccgtctgttcg
gcctacgacgcgcggctgcgccagaaggtggcggtgaagaagctgtcgcgccccttccag
tcgctgatccacgcgcgcaggacgtaccgggagctgcggctgctcaagcacctgaagcac
gagaacgtcatcgggcttctggacgtcttcacgccggccacgtccatcgaggacttcagc
gaagtgtacttggtgaccaccctcatgggtgccgacctgaacaacatcgtcaagtgccag
gcgctgagcgacgagcacgttcagttcctggtttaccaactgctgcgcgggctaaagtac
atccactcggccgggatcatccaccgggacctgaagcccagcaacgtggctgtgaacgag
gactgtgagctcaggatcctggacttcgggctggcgcgccaggcagatgaggagatgacc
ggctacgtggccacgcgctggtaccgggcacctgagataatgctaaactggatgcattac
aaccagacagtggacatctggtccgttggctgcatcatggctgagctgctccagggcaag
gccctcttcccgggaagcgactacattgaccagctgaagcgcatcatggaagtggtgggc
acacccagccccgaggttctggcaaagatctcctcggaacacgcccggacatacatccag
tccctgccccccatgccccagaaggacctgagcagcatcttccatggagccaaccccctg
gccatagacctccttggaaggatgctggtgctggacagtgaccagagggtcagtgctgcc
gaggcattggcccacgcctacttcagccagtaccatgaccctgaggatgagccagaggcc
gagccgtatgatgagagcgttgaggctaaggagcgcacgctggaggagtggaaggagctc
acctaccaggaagtcctcagcttcaagcccccagagccaccgaagccacctggcagcctg
gagattgagcagtga

KEGG   Macaca mulatta (rhesus monkey): 718976
Entry
718976            CDS       T01028                                 

Gene name
MAPK14
Definition
(RefSeq) mitogen-activated protein kinase 14 isoform X1
  KO
K04441  p38 MAP kinase [EC:2.7.11.24]
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc01522  Endocrine resistance
mcc04010  MAPK signaling pathway
mcc04015  Rap1 signaling pathway
mcc04068  FoxO signaling pathway
mcc04071  Sphingolipid signaling pathway
mcc04114  Oocyte meiosis
mcc04218  Cellular senescence
mcc04261  Adrenergic signaling in cardiomyocytes
mcc04370  VEGF signaling pathway
mcc04380  Osteoclast differentiation
mcc04550  Signaling pathways regulating pluripotency of stem cells
mcc04611  Platelet activation
mcc04620  Toll-like receptor signaling pathway
mcc04621  NOD-like receptor signaling pathway
mcc04622  RIG-I-like receptor signaling pathway
mcc04625  C-type lectin receptor signaling pathway
mcc04657  IL-17 signaling pathway
mcc04658  Th1 and Th2 cell differentiation
mcc04659  Th17 cell differentiation
mcc04660  T cell receptor signaling pathway
mcc04664  Fc epsilon RI signaling pathway
mcc04668  TNF signaling pathway
mcc04670  Leukocyte transendothelial migration
mcc04714  Thermogenesis
mcc04722  Neurotrophin signaling pathway
mcc04723  Retrograde endocannabinoid signaling
mcc04728  Dopaminergic synapse
mcc04750  Inflammatory mediator regulation of TRP channels
mcc04912  GnRH signaling pathway
mcc04914  Progesterone-mediated oocyte maturation
mcc04917  Prolactin signaling pathway
mcc04926  Relaxin signaling pathway
mcc04933  AGE-RAGE signaling pathway in diabetic complications
mcc04935  Growth hormone synthesis, secretion and action
mcc05014  Amyotrophic lateral sclerosis
mcc05020  Prion disease
mcc05022  Pathways of neurodegeneration - multiple diseases
mcc05132  Salmonella infection
mcc05133  Pertussis
mcc05135  Yersinia infection
mcc05140  Leishmaniasis
mcc05142  Chagas disease
mcc05145  Toxoplasmosis
mcc05152  Tuberculosis
mcc05161  Hepatitis B
mcc05163  Human cytomegalovirus infection
mcc05167  Kaposi sarcoma-associated herpesvirus infection
mcc05169  Epstein-Barr virus infection
mcc05170  Human immunodeficiency virus 1 infection
mcc05171  Coronavirus disease - COVID-19
mcc05205  Proteoglycans in cancer
mcc05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
mcc05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    718976 (MAPK14)
   04015 Rap1 signaling pathway
    718976 (MAPK14)
   04370 VEGF signaling pathway
    718976 (MAPK14)
   04668 TNF signaling pathway
    718976 (MAPK14)
   04068 FoxO signaling pathway
    718976 (MAPK14)
   04071 Sphingolipid signaling pathway
    718976 (MAPK14)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    718976 (MAPK14)
   04218 Cellular senescence
    718976 (MAPK14)
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    718976 (MAPK14)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    718976 (MAPK14)
   04620 Toll-like receptor signaling pathway
    718976 (MAPK14)
   04621 NOD-like receptor signaling pathway
    718976 (MAPK14)
   04622 RIG-I-like receptor signaling pathway
    718976 (MAPK14)
   04625 C-type lectin receptor signaling pathway
    718976 (MAPK14)
   04660 T cell receptor signaling pathway
    718976 (MAPK14)
   04658 Th1 and Th2 cell differentiation
    718976 (MAPK14)
   04659 Th17 cell differentiation
    718976 (MAPK14)
   04657 IL-17 signaling pathway
    718976 (MAPK14)
   04664 Fc epsilon RI signaling pathway
    718976 (MAPK14)
   04670 Leukocyte transendothelial migration
    718976 (MAPK14)
  09152 Endocrine system
   04912 GnRH signaling pathway
    718976 (MAPK14)
   04914 Progesterone-mediated oocyte maturation
    718976 (MAPK14)
   04917 Prolactin signaling pathway
    718976 (MAPK14)
   04926 Relaxin signaling pathway
    718976 (MAPK14)
   04935 Growth hormone synthesis, secretion and action
    718976 (MAPK14)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    718976 (MAPK14)
  09156 Nervous system
   04728 Dopaminergic synapse
    718976 (MAPK14)
   04723 Retrograde endocannabinoid signaling
    718976 (MAPK14)
   04722 Neurotrophin signaling pathway
    718976 (MAPK14)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    718976 (MAPK14)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    718976 (MAPK14)
  09159 Environmental adaptation
   04714 Thermogenesis
    718976 (MAPK14)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    718976 (MAPK14)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    718976 (MAPK14)
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    718976 (MAPK14)
   05020 Prion disease
    718976 (MAPK14)
   05022 Pathways of neurodegeneration - multiple diseases
    718976 (MAPK14)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    718976 (MAPK14)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    718976 (MAPK14)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    718976 (MAPK14)
   05135 Yersinia infection
    718976 (MAPK14)
   05133 Pertussis
    718976 (MAPK14)
   05152 Tuberculosis
    718976 (MAPK14)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    718976 (MAPK14)
   05161 Hepatitis B
    718976 (MAPK14)
   05171 Coronavirus disease - COVID-19
    718976 (MAPK14)
   05163 Human cytomegalovirus infection
    718976 (MAPK14)
   05167 Kaposi sarcoma-associated herpesvirus infection
    718976 (MAPK14)
   05169 Epstein-Barr virus infection
    718976 (MAPK14)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    718976 (MAPK14)
   05140 Leishmaniasis
    718976 (MAPK14)
   05142 Chagas disease
    718976 (MAPK14)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    718976 (MAPK14)
Enzymes [BR:mcc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     718976 (MAPK14)
Protein kinases [BR:mcc01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   718976 (MAPK14)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kdo APH NAD_binding_8 Kinase-like
Other DBs
NCBI-GeneID: 718976
NCBI-ProteinID: XP_014991719
Ensembl: ENSMMUG00000008444
UniProt: G7MRU1 A0A5S6R967
LinkDB
Position
4
AA seq 360 aa
MSQERPTFYRQELNKTIWEVPERYQNLSPVGSGAYGSVCAAFDTKTGLRVAVKKLSRPFQ
SIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIVKCQ
KLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFGLARHTDDEMT
GYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVG
TPGAELLKKISSESARNYIQSLTQMPKMNFANVFIGANPLAVDLLEKMLVLDSDKRITAA
QALAHAYFAQYHDPDDEPVADPYDQSFESRDLLIDEWKSLTYDEVVSFVPPPLDQEEMES
NT seq 1083 nt   +upstreamnt  +downstreamnt
atgtctcaggagaggcccacgttctaccggcaggagctgaacaagacaatctgggaggtg
cccgagcgttaccagaacctgtctccagtgggctccggcgcctatggctctgtgtgtgcc
gcttttgacacaaaaacggggttacgtgtggcagtgaagaagctctccagaccatttcag
tccatcattcatgccaaaagaacctacagagaactgcggttacttaaacatatgaaacat
gaaaatgtgattggtctgttggacgtttttacacctgcaaggtctctggaggaattcaat
gatgtgtatctggtgacccatctcatgggggcagatctgaacaacattgtgaaatgtcag
aagcttacagatgaccatgttcagttccttatctaccaaattctccgaggtctaaagtat
atacattcagccgacataattcacagggacctaaaacctagtaatctagctgtgaatgaa
gactgtgagctgaagattctggattttggactggctcggcacacagatgatgaaatgaca
ggctacgtggccactaggtggtacagggctcctgagatcatgctgaactggatgcattac
aaccagacagttgatatttggtcagtgggatgcataatggccgagctgttgactggaaga
acattgtttcctggcacagaccatattgatcagttgaagctcattttaagactcgttgga
accccaggggctgagcttttgaagaaaatctcctcagagtctgcaagaaactatattcag
tctttgacgcagatgccgaagatgaactttgcgaatgtatttattggtgccaatcccctg
gctgtcgacttgctggagaagatgcttgtattggactcagataagagaattacagcagcc
caagcccttgcacatgcctactttgctcagtaccacgatcctgatgatgaaccagtggcc
gatccttatgatcagtcctttgaaagcagggacctccttatagatgagtggaaaagcctg
acctatgatgaagtcgtcagctttgtgccaccgcccctcgaccaagaagagatggagtcc
tga

KEGG   Macaca mulatta (rhesus monkey): 719085
Entry
719085            CDS       T01028                                 

Gene name
MAPK13
Definition
(RefSeq) mitogen-activated protein kinase 13 isoform X1
  KO
K04441  p38 MAP kinase [EC:2.7.11.24]
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc01522  Endocrine resistance
mcc04010  MAPK signaling pathway
mcc04015  Rap1 signaling pathway
mcc04068  FoxO signaling pathway
mcc04071  Sphingolipid signaling pathway
mcc04114  Oocyte meiosis
mcc04218  Cellular senescence
mcc04261  Adrenergic signaling in cardiomyocytes
mcc04370  VEGF signaling pathway
mcc04380  Osteoclast differentiation
mcc04550  Signaling pathways regulating pluripotency of stem cells
mcc04611  Platelet activation
mcc04620  Toll-like receptor signaling pathway
mcc04621  NOD-like receptor signaling pathway
mcc04622  RIG-I-like receptor signaling pathway
mcc04625  C-type lectin receptor signaling pathway
mcc04657  IL-17 signaling pathway
mcc04658  Th1 and Th2 cell differentiation
mcc04659  Th17 cell differentiation
mcc04660  T cell receptor signaling pathway
mcc04664  Fc epsilon RI signaling pathway
mcc04668  TNF signaling pathway
mcc04670  Leukocyte transendothelial migration
mcc04714  Thermogenesis
mcc04722  Neurotrophin signaling pathway
mcc04723  Retrograde endocannabinoid signaling
mcc04728  Dopaminergic synapse
mcc04750  Inflammatory mediator regulation of TRP channels
mcc04912  GnRH signaling pathway
mcc04914  Progesterone-mediated oocyte maturation
mcc04917  Prolactin signaling pathway
mcc04926  Relaxin signaling pathway
mcc04933  AGE-RAGE signaling pathway in diabetic complications
mcc04935  Growth hormone synthesis, secretion and action
mcc05014  Amyotrophic lateral sclerosis
mcc05020  Prion disease
mcc05022  Pathways of neurodegeneration - multiple diseases
mcc05132  Salmonella infection
mcc05133  Pertussis
mcc05135  Yersinia infection
mcc05140  Leishmaniasis
mcc05142  Chagas disease
mcc05145  Toxoplasmosis
mcc05152  Tuberculosis
mcc05161  Hepatitis B
mcc05163  Human cytomegalovirus infection
mcc05167  Kaposi sarcoma-associated herpesvirus infection
mcc05169  Epstein-Barr virus infection
mcc05170  Human immunodeficiency virus 1 infection
mcc05171  Coronavirus disease - COVID-19
mcc05205  Proteoglycans in cancer
mcc05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
mcc05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    719085 (MAPK13)
   04015 Rap1 signaling pathway
    719085 (MAPK13)
   04370 VEGF signaling pathway
    719085 (MAPK13)
   04668 TNF signaling pathway
    719085 (MAPK13)
   04068 FoxO signaling pathway
    719085 (MAPK13)
   04071 Sphingolipid signaling pathway
    719085 (MAPK13)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    719085 (MAPK13)
   04218 Cellular senescence
    719085 (MAPK13)
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    719085 (MAPK13)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    719085 (MAPK13)
   04620 Toll-like receptor signaling pathway
    719085 (MAPK13)
   04621 NOD-like receptor signaling pathway
    719085 (MAPK13)
   04622 RIG-I-like receptor signaling pathway
    719085 (MAPK13)
   04625 C-type lectin receptor signaling pathway
    719085 (MAPK13)
   04660 T cell receptor signaling pathway
    719085 (MAPK13)
   04658 Th1 and Th2 cell differentiation
    719085 (MAPK13)
   04659 Th17 cell differentiation
    719085 (MAPK13)
   04657 IL-17 signaling pathway
    719085 (MAPK13)
   04664 Fc epsilon RI signaling pathway
    719085 (MAPK13)
   04670 Leukocyte transendothelial migration
    719085 (MAPK13)
  09152 Endocrine system
   04912 GnRH signaling pathway
    719085 (MAPK13)
   04914 Progesterone-mediated oocyte maturation
    719085 (MAPK13)
   04917 Prolactin signaling pathway
    719085 (MAPK13)
   04926 Relaxin signaling pathway
    719085 (MAPK13)
   04935 Growth hormone synthesis, secretion and action
    719085 (MAPK13)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    719085 (MAPK13)
  09156 Nervous system
   04728 Dopaminergic synapse
    719085 (MAPK13)
   04723 Retrograde endocannabinoid signaling
    719085 (MAPK13)
   04722 Neurotrophin signaling pathway
    719085 (MAPK13)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    719085 (MAPK13)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    719085 (MAPK13)
  09159 Environmental adaptation
   04714 Thermogenesis
    719085 (MAPK13)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    719085 (MAPK13)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    719085 (MAPK13)
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    719085 (MAPK13)
   05020 Prion disease
    719085 (MAPK13)
   05022 Pathways of neurodegeneration - multiple diseases
    719085 (MAPK13)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    719085 (MAPK13)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    719085 (MAPK13)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    719085 (MAPK13)
   05135 Yersinia infection
    719085 (MAPK13)
   05133 Pertussis
    719085 (MAPK13)
   05152 Tuberculosis
    719085 (MAPK13)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    719085 (MAPK13)
   05161 Hepatitis B
    719085 (MAPK13)
   05171 Coronavirus disease - COVID-19
    719085 (MAPK13)
   05163 Human cytomegalovirus infection
    719085 (MAPK13)
   05167 Kaposi sarcoma-associated herpesvirus infection
    719085 (MAPK13)
   05169 Epstein-Barr virus infection
    719085 (MAPK13)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    719085 (MAPK13)
   05140 Leishmaniasis
    719085 (MAPK13)
   05142 Chagas disease
    719085 (MAPK13)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    719085 (MAPK13)
Enzymes [BR:mcc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     719085 (MAPK13)
Protein kinases [BR:mcc01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   719085 (MAPK13)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr APH Kdo Kinase-like DUF4023 FTA2
Other DBs
NCBI-GeneID: 719085
NCBI-ProteinID: XP_014991726
Ensembl: ENSMMUG00000005903
LinkDB
Position
4
AA seq 401 aa
MSLIRKKGFYKQDVNKTAWELPKTYVSPTHVGSGAYGAVWTMPLQDPGVHRADPHCYRQV
HRGPKRGRWLAKLQRDSAIDKRSGEKVAIKKLSRPFQSEIFAKRAYRELLLLKHMQHENV
IGLLDVFTPASSLRNFHDFYLVMPFMQTDLQKIMGMEFSEEKIQYLVYQMLKGLKYIHSA
GVVHRDLKPGNLAVNEDCELKILDFGLARHADAEMTGYVVTRWYRAPEVILSWMHYNQTV
DIWSVGCIMAEMLTGKTLFKGKDYLDQLTQILKVTGVPGTEFVQKLNDKAAKSYIQSLPQ
TPKKDFTQLFPRASPQAVDLLEKMLELDVDKRLTAAQALTHPFFEPFRDPEEETEAQQPF
DDSLEHEKLTVDEWKQHIYKEIVNFSPIARKDSRRRSGMKL
NT seq 1206 nt   +upstreamnt  +downstreamnt
atgagcctcatccggaaaaagggattctacaagcaggacgtcaacaagaccgcctgggag
ctgcccaagacctacgtgtccccgacgcacgtcggcagcggggcctatggcgcggtgtgg
actatgcccttgcaagatcccggagttcatcgggcagatcctcactgttacagacaagta
caccgaggccccaagagggggaggtggctcgccaagttgcagagagactcggccatcgac
aagcggtcaggggagaaggtggccatcaagaagctgagccggccctttcagtccgagatc
ttcgccaagcgcgcctaccgggagctgctgctgctgaagcacatgcagcatgagaacgtc
attgggctcctggatgtcttcaccccagcctcctccctgcgcaacttccatgacttctac
ctggtgatgcccttcatgcagacggatctgcagaagatcatggggatggagttcagtgag
gagaagatccagtacctggtgtatcagatgctcaaaggccttaagtacatccactcggct
ggggtcgtgcacagggacctgaagccaggcaacctagctgtgaacgaggactgtgaactg
aagatcctggattttgggctggcgcggcatgcagatgccgagatgactggctacgtggtg
acccgctggtaccgggcccccgaggtgatcctcagctggatgcactacaaccagacagtg
gacatctggtctgtgggctgtatcatggcagagatgctgacagggaaaactctgttcaag
gggaaagattacctggaccagctgacccagatcctgaaagtgaccggggtgccaggcacg
gagtttgtgcagaagctgaacgacaaagcggccaaatcctacatccagtccctgccacag
acccccaagaaggatttcactcagctcttcccgcgggccagcccccaggctgtggacctg
ctggagaagatgctggagctagatgtggacaagcgcctgacagccgcgcaggccctcacc
catcccttctttgaacccttccgggaccctgaggaagagacggaggcccaacagccattt
gatgattccttagaacacgagaaactcacagtggatgaatggaagcagcacatctacaag
gagattgtgaacttcagccccattgcccggaaggactcacggcgccggagtggcatgaaa
ctgtag

DBGET integrated database retrieval system