KEGG   Macaca mulatta (rhesus monkey): 716043
Entry
716043            CDS       T01028                                 

Gene name
CD274
Definition
(RefSeq) programmed cell death 1 ligand 1 precursor
  KO
K06745  programmed cell death 1 ligand 1
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04514  Cell adhesion molecules
mcc05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    716043 (CD274)
 09160 Human Diseases
  09161 Cancer: overview
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    716043 (CD274)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:mcc04090]
    716043 (CD274)
CD molecules [BR:mcc04090]
 Proteins
  716043 (CD274)
SSDB
Motif
Pfam: Ig_3 I-set ig C2-set_2 V-set Ig_2 C1-set Ig_6 V-set_CD47 Izumo-Ig Herpes_gE
Other DBs
NCBI-GeneID: 716043
NCBI-ProteinID: NP_001077358
Ensembl: ENSMMUG00000012235
UniProt: A4GW29
LinkDB
Position
15
AA seq 290 aa
MRIFAVFIFTIYWHLLNAFTVTVPKDLYVVEYGSNMTIECRFPVEKQLGLTSLIVYWEME
DKNIIQFVHGEEDLKVQHSNYRQRAQLLKDQLSLGNAALRITDVKLQDAGVYRCMISYGG
ADYKRITVKVNAPYNKINQRILVVDPVTSEHELTCQAEGYPKAEVIWTSSDHQVLSGKTT
TTNSKREEKLLNVTSTLRINTTANEIFYCIFRRLGPEENHTAELVIPELPLALPPNERTH
LVILGAIFLLLGVALTFIFYLRKGRMMDMKKSGIRVTNSKKQRDTQLEET
NT seq 873 nt   +upstreamnt  +downstreamnt
atgaggatatttgctgtctttatattcacgatctactggcatttgctgaatgcatttact
gtcacggttcccaaggacctatatgtggtagagtatggcagcaatatgacaattgaatgc
agattcccagtagaaaaacaattaggcctgacttcactaattgtctattgggaaatggag
gataagaacattattcaatttgtgcatggagaggaagacctgaaggttcagcatagtaac
tatagacagagggcccagctgttgaaggaccagctctccctgggaaatgctgcacttcgg
atcacagatgtgaaattgcaggatgcaggggtttaccgctgcatgatcagctatggtggt
gccgactacaagcggattaccgtgaaagtcaatgctccatacaacaaaatcaaccaaaga
attttggttgtcgatccagtcacctctgaacatgaactaacatgtcaggctgagggctac
cccaaggccgaagtcatttggacaagcagtgaccatcaagtcctgagtggtaagaccacc
accaccaattccaagagagaggagaagcttttaaatgtgaccagcacactgagaatcaac
acaacagctaatgagattttctactgcatttttaggagattaggtcctgaggaaaaccat
acagctgaattggtcatcccagaactacctctggcgcttcctccaaatgaaaggactcac
ttggtaattctgggagccatctttttactccttggtgtagcactgacattcatcttctat
ttaagaaaagggagaatgatggatatgaaaaaaagtggcattcgagttacaaactcaaag
aagcaacgtgatacacaattggaggagacgtaa

DBGET integrated database retrieval system