KEGG   Macaca mulatta (rhesus monkey): 716141Help
Entry
716141            CDS       T01028                                 

Gene name
SETDB1
Definition
(RefSeq) SET domain bifurcated 1
  KO
K11421  histone-lysine N-methyltransferase SETDB1 [EC:2.1.1.43]
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc00310  Lysine degradation
mcc04550  Signaling pathways regulating pluripotency of stem cells
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    716141 (SETDB1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    716141 (SETDB1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mcc03036]
    716141 (SETDB1)
Enzymes [BR:mcc01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     716141 (SETDB1)
Chromosome and associated proteins [BR:mcc03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     716141 (SETDB1)
  Heterochromatin formation proteins
   Other heterochromatin formation proteins
    716141 (SETDB1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SET DUF5604 Tudor_4 TUDOR_5 Pre-SET MBD DUF4537 53-BP1_Tudor Chromo
Motif
Other DBs
NCBI-GeneID: 716141
NCBI-ProteinID: XP_015007272
Ensembl: ENSMMUG00000023235
UniProt: H9G2L0
LinkDB All DBs
Position
1
AA seq 1292 aa AA seqDB search
MSSLPGCIGLDAATATVESEEIAELQQAVVEELGISMEELRHFIDEELEKMDCVQQRKKQ
LAELETWVIQKESEVAHVDQLFDDASRAVTNCESLVKDFYSKLGLQYRDSSSEDESSRPT
EIIEIPDEDDDVLSIDSGDAGSRTPKDQKLREAMAALRKSAQDVQKFMDAVNKKSSSQDL
HKGTLSQMSGELSKDGDLIVSMRILGKKRTKTWHKGTLIAIQTVGPGKKYKVKFDNKGKS
LLSGNHIAYDYHPPADKLFVGSRVVAKYKDGNQVWLYAGIVAETPNVKNKLRFLIFFDDG
YASYVTQSELYPICRPLKKTWEDIEDISCRDFIEEYVTAYPNRPMVLLKSGQLIKTEWEG
TWWKSRVEEVDGSLVRILFLDDKRCEWIYRGSTRLEPMFSMKTSSASALEKKQGQLRTRP
NMGAVRSKGPVVQYTQDLTGTGTQFKPVEPPQPTAPPAPPFPPASPLSPQAGDSESLESQ
LAQSRKQVAKKSTSFRPGSVGSGHSSPTSPALSENVSGGKPGINQTYRSPLGSTASAPAP
SAPPAPPAPPAFHGMLERAPAEPSYRAPMEKLFYLPHVCSYTCLSRVRPMRNEQYRGKNP
LLVPLLYDFRRMTARRRVNRKMGFHVIYKTPCGLCLRTMQEIERYLFETGCDFLFLEMFC
LDPYVLVDRKFQPYKPFYYILDITYGKEDVPLSCVNEIDTTPPPQVAYSKERIPGKGVFI
NTGPEFLVGCDCKDGCRDKSKCACHQLTIQATACTPGGQINPNSGYQYKRLEECLPTGVY
ECNKRCKCDPNMCTNRLVQHGLQVRLQLFKTQNKGWGIRCLDDIAKGSFVCIYAGKILTD
DFADKEGLEMGDEYFANLDHIESVENFKEGYESDAPCSSDSSGVDLKDQEDGNSGTEDPE
ESNDDSSDDNFCKDEDFSTSSVWRSYATRRQTRGQKENGLSETTSKDSHPPDLGPLHIPV
PPPIPVGGCNPPSSEETPKNKVASWLSCNSVSEGGFADSDSHSSFKTNEGGEGRAGGSRM
EAEKASTSGLGIKDEGDIKQAKKEDPDDRNKMSVVTESSRNYGYNPSPVKPEGLRRPPSK
TSMHQSRRLMASAQSNPDDVLTLSSSTESEGESGTSRKPTAGQTSATAVDSDDIQTISSG
SEGDDFEDKKNMTGPMKRQVAVKSTRGFALKSTHGIAIKSTNMASVDKGESAPVRKNTRQ
FYDGEESCYIIDAKLEGNLGRYLNHSCSPNLFVQNVFVDTHDLRFPWVAFFASKRIRAGT
ELTWDYNYEVGSVEGKELLCCCGAIECRGRLL
NT seq 3879 nt NT seq  +upstreamnt  +downstreamnt
atgtcttcccttcctgggtgcattggtttggatgcagcaacagctacagtggagtctgaa
gagatagcagagctgcaacaggcagtggttgaggaactgggtatctctatggaggaactt
cggcatttcatcgatgaggaactggagaagatggattgtgtacagcagcgcaagaaacag
ctagcagagttagagacatgggtaatacagaaagaatctgaggtggctcacgttgaccag
ctatttgatgatgcatccagggcagtgactaattgtgagtctttggtgaaggacttctac
tccaagctgggactacaataccgggacagtagctctgaggacgaatcttcccggcctaca
gaaataattgagattcctgatgaagatgatgatgtcctcagtattgattcaggtgatgct
gggagccgaactccaaaagaccagaagctccgtgaagctatggctgccttaagaaagtca
gctcaagatgttcagaagttcatggatgctgtcaacaagaagagcagttcccaggatctg
cataaaggaaccttgagtcagatgtctggagaactaagcaaagatggtgacctgatagtc
agcatgcgaattctgggcaagaaaagaactaagacatggcacaaaggcacccttattgcc
atccagacagttgggccggggaagaaatacaaggtgaaatttgacaacaaaggaaagagt
ctactgtcggggaaccatattgcctatgattaccaccctcctgctgacaagctgtttgtg
ggcagtcgggtggtcgccaaatacaaagatgggaatcaggtctggctctatgctggcatt
gtagctgagacaccaaacgtcaaaaacaagctcaggtttctcattttctttgatgatggc
tatgcttcctatgtcacacagtctgaactgtatcccatttgccggccactgaaaaagact
tgggaggacatagaagacatctcctgccgtgacttcatagaggagtatgtaactgcctac
cccaaccgccccatggtactgctcaagagtggccagcttatcaagactgagtgggaaggc
acatggtggaagtcccgagttgaggaggtggatggcagcctagtcaggatcctcttcctg
gatgacaaaagatgtgagtggatctatcgaggctctacacggctggagcccatgttcagc
atgaaaacatcctcagcctctgcactggagaagaagcaaggacagctcaggacacgtcca
aatatgggtgctgtgaggagcaaaggccctgttgtccagtacacacaggatctgactggt
actggaacccagtttaagccagtggaacccccacagcctacagctccacctgccccacct
ttcccacctgcttcacctctatctccccaagcaggtgacagtgaaagcttggaaagccag
cttgcccagtcacggaagcaggtagccaaaaagagcacatccttccgaccaggatctgtg
ggctctggtcattcctcccctacgtctcctgcactcagtgaaaatgtctctggtgggaaa
cctgggatcaaccagacgtatagatcacctttaggctccacagcctctgccccagcaccc
tcagcacccccagcccctccagcacccccagccttccatggcatgctggagcgggcccca
gcagagccctcctaccgtgctcccatggagaagcttttctacttacctcatgtctgcagc
tatacctgtctgtctcgagtcagacctatgaggaatgagcagtaccggggcaagaaccct
ctgctggttccattactgtatgacttccggcggatgacagcccggcgtcgagttaaccgc
aagatgggctttcatgttatctataagacaccttgtggtctttgccttcggacaatgcag
gagatcgaacgctaccttttcgagactggctgtgacttcctcttcctggagatgttctgt
ttggatccatatgttcttgtggaccgaaagtttcagccctataagcctttttactatatt
ttggacatcacctatgggaaggaagatgttcccctatcctgtgtcaatgagattgacaca
acccctccaccccaggtggcctacagcaaggaacgtatcccgggcaagggtgttttcatt
aacacaggccctgaatttctggttggctgtgactgcaaggatgggtgtcgggacaagtcc
aagtgtgcctgccatcaactaactatccaggctacagcctgtaccccaggaggccaaatc
aaccctaactctggctaccagtacaagagactagaagagtgtctacccacaggggtatat
gagtgtaacaaacgctgcaaatgtgacccaaacatgtgcacaaaccggttggtacaacat
ggactacaagttcggctacagctattcaagacacagaacaagggctggggtatccgctgc
ttggatgacattgccaaaggctcttttgtctgtatttatgcaggcaaaatcctgacagat
gactttgcagacaaggagggtctggaaatgggtgatgagtactttgcaaatctggaccat
atcgagagcgtggagaacttcaaagaaggatatgagagtgatgccccctgttcctctgac
agcagtggtgtagacttgaaggaccaggaagatggcaacagcggtacagaggaccctgaa
gagtccaatgatgatagctcagatgataacttctgtaaggatgaggacttcagcaccagt
tcagtgtggcggagctatgctacccggagacagacccggggccagaaagagaacggactc
tctgagacaacttccaaggactcccaccccccagatcttggacccctacatattcctgtt
cctcccccaatccctgtaggtggctgcaatccaccttcctctgaagagacacccaagaac
aaggtggcctcatggttgagctgcaatagtgtcagtgaaggtggttttgctgactctgat
agccattcatcctttaagactaatgaaggtggggagggccgggctgggggaagccgaatg
gaggctgaaaaggcctccacctcaggactaggcatcaaggatgagggagacatcaagcag
gccaagaaagaggaccctgacgaccgaaacaagatgtcagtagttactgaaagctctcga
aactacggttacaatccttctcccgtgaagcctgaaggacttcgccgcccacctagtaag
actagtatgcatcaaagccgacgactcatggcttctgctcagtccaaccctgatgatgtc
ctgacactgtccagcagcacagaaagtgagggggaaagtgggaccagccgaaagcccact
gctggtcagacttcggctacagcggttgacagtgatgatatccagaccatctcctctggc
tctgaaggggatgactttgaggacaagaagaacatgactggtccaatgaagcgtcaagtg
gcagtaaagtcaacccgaggctttgcccttaaatcaacccatgggattgcaattaaatca
accaacatggcctctgtggacaagggggagagtgcacctgttcgtaagaacacacgccaa
ttctacgatggcgaggagtcttgctacatcatcgatgccaagcttgaaggcaacctgggc
cgctacctcaaccacagttgcagccccaacctgtttgtccagaatgtcttcgtggatacc
catgatcttcgctttccctgggtggccttctttgccagcaaaagaatccgggctgggaca
gaacttacttgggactacaactacgaggtgggcagtgtggaaggcaaggagctgctctgt
tgctgtggggccattgaatgcagaggacgtcttctttag

DBGET integrated database retrieval system