KEGG   Macaca mulatta (rhesus monkey): 716170
Entry
716170            CDS       T01028                                 

Gene name
TP53
Definition
(RefSeq) cellular tumor antigen p53
  KO
K04451  tumor protein p53
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc01522  Endocrine resistance
mcc01524  Platinum drug resistance
mcc04010  MAPK signaling pathway
mcc04071  Sphingolipid signaling pathway
mcc04110  Cell cycle
mcc04115  p53 signaling pathway
mcc04137  Mitophagy - animal
mcc04151  PI3K-Akt signaling pathway
mcc04210  Apoptosis
mcc04211  Longevity regulating pathway
mcc04216  Ferroptosis
mcc04218  Cellular senescence
mcc04310  Wnt signaling pathway
mcc04722  Neurotrophin signaling pathway
mcc04919  Thyroid hormone signaling pathway
mcc05012  Parkinson disease
mcc05014  Amyotrophic lateral sclerosis
mcc05016  Huntington disease
mcc05160  Hepatitis C
mcc05161  Hepatitis B
mcc05162  Measles
mcc05163  Human cytomegalovirus infection
mcc05165  Human papillomavirus infection
mcc05166  Human T-cell leukemia virus 1 infection
mcc05167  Kaposi sarcoma-associated herpesvirus infection
mcc05168  Herpes simplex virus 1 infection
mcc05169  Epstein-Barr virus infection
mcc05200  Pathways in cancer
mcc05202  Transcriptional misregulation in cancer
mcc05203  Viral carcinogenesis
mcc05205  Proteoglycans in cancer
mcc05206  MicroRNAs in cancer
mcc05210  Colorectal cancer
mcc05212  Pancreatic cancer
mcc05213  Endometrial cancer
mcc05214  Glioma
mcc05215  Prostate cancer
mcc05216  Thyroid cancer
mcc05217  Basal cell carcinoma
mcc05218  Melanoma
mcc05219  Bladder cancer
mcc05220  Chronic myeloid leukemia
mcc05222  Small cell lung cancer
mcc05223  Non-small cell lung cancer
mcc05224  Breast cancer
mcc05225  Hepatocellular carcinoma
mcc05226  Gastric cancer
mcc05230  Central carbon metabolism in cancer
mcc05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    716170 (TP53)
   04310 Wnt signaling pathway
    716170 (TP53)
   04071 Sphingolipid signaling pathway
    716170 (TP53)
   04151 PI3K-Akt signaling pathway
    716170 (TP53)
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    716170 (TP53)
  09143 Cell growth and death
   04110 Cell cycle
    716170 (TP53)
   04210 Apoptosis
    716170 (TP53)
   04216 Ferroptosis
    716170 (TP53)
   04115 p53 signaling pathway
    716170 (TP53)
   04218 Cellular senescence
    716170 (TP53)
 09150 Organismal Systems
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    716170 (TP53)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    716170 (TP53)
  09149 Aging
   04211 Longevity regulating pathway
    716170 (TP53)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    716170 (TP53)
   05202 Transcriptional misregulation in cancer
    716170 (TP53)
   05206 MicroRNAs in cancer
    716170 (TP53)
   05205 Proteoglycans in cancer
    716170 (TP53)
   05203 Viral carcinogenesis
    716170 (TP53)
   05230 Central carbon metabolism in cancer
    716170 (TP53)
  09162 Cancer: specific types
   05210 Colorectal cancer
    716170 (TP53)
   05212 Pancreatic cancer
    716170 (TP53)
   05225 Hepatocellular carcinoma
    716170 (TP53)
   05226 Gastric cancer
    716170 (TP53)
   05214 Glioma
    716170 (TP53)
   05216 Thyroid cancer
    716170 (TP53)
   05220 Chronic myeloid leukemia
    716170 (TP53)
   05217 Basal cell carcinoma
    716170 (TP53)
   05218 Melanoma
    716170 (TP53)
   05219 Bladder cancer
    716170 (TP53)
   05215 Prostate cancer
    716170 (TP53)
   05213 Endometrial cancer
    716170 (TP53)
   05224 Breast cancer
    716170 (TP53)
   05222 Small cell lung cancer
    716170 (TP53)
   05223 Non-small cell lung cancer
    716170 (TP53)
  09164 Neurodegenerative disease
   05012 Parkinson disease
    716170 (TP53)
   05014 Amyotrophic lateral sclerosis
    716170 (TP53)
   05016 Huntington disease
    716170 (TP53)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    716170 (TP53)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    716170 (TP53)
   05161 Hepatitis B
    716170 (TP53)
   05160 Hepatitis C
    716170 (TP53)
   05162 Measles
    716170 (TP53)
   05168 Herpes simplex virus 1 infection
    716170 (TP53)
   05163 Human cytomegalovirus infection
    716170 (TP53)
   05167 Kaposi sarcoma-associated herpesvirus infection
    716170 (TP53)
   05169 Epstein-Barr virus infection
    716170 (TP53)
   05165 Human papillomavirus infection
    716170 (TP53)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    716170 (TP53)
   01522 Endocrine resistance
    716170 (TP53)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mcc03000]
    716170 (TP53)
   03036 Chromosome and associated proteins [BR:mcc03036]
    716170 (TP53)
   03400 DNA repair and recombination proteins [BR:mcc03400]
    716170 (TP53)
Transcription factors [BR:mcc03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   p53
    716170 (TP53)
Chromosome and associated proteins [BR:mcc03036]
 Eukaryotic type
  Sister chromatid separation proteins
   Aurora kinases
    Regulators of Aurora kinases
     716170 (TP53)
DNA repair and recombination proteins [BR:mcc03400]
 Eukaryotic type
  Check point factors
   Other check point factors
    716170 (TP53)
SSDB
Motif
Pfam: P53 P53_tetramer TAD2 P53_TAD
Other DBs
NCBI-GeneID: 716170
NCBI-ProteinID: NP_001040616
Ensembl: ENSMMUG00000008639
UniProt: P56424 E3U906 G7NIG9
LinkDB
Position
16
AA seq 393 aa
MEEPQSDPSIEPPLSQETFSDLWKLLPENNVLSPLPSQAVDDLMLSPDDLAQWLTEDPGP
DEAPRMSEAAPPMAPTPAAPTPAAPAPAPSWPLSSSVPSQKTYHGSYGFRLGFLHSGTAK
SVTCTYSPDLNKMFCQLAKTCPVQLWVDSTPPPGSRVRAMAIYKQSQHMTEVVRRCPHHE
RCSDSDGLAPPQHLIRVEGNLRVEYSDDRNTFRHSVVVPYEPPEVGSDCTTIHYNYMCNS
SCMGGMNRRPILTIITLEDSSGNLLGRNSFEVRVCACPGRDRRTEEENFRKKGEPCHQLP
PGSTKRALPNNTSSSPQPKKKPLDGEYFTLQIRGRERFEMFRELNEALELKDAQAGKEPA
GSRAHSSHLKSKKGQSTSRHKKFMFKTEGPDSD
NT seq 1182 nt   +upstreamnt  +downstreamnt
atggaggagccgcagtcagatcctagcatcgagccccctctgagtcaggaaacattttca
gacctatggaaactacttcctgaaaacaacgttctgtcccccttgccgtcccaagcagtg
gatgatttgatgctgtctccagacgatcttgcacaatggttaactgaagacccaggtcca
gatgaagctccgagaatgtcagaggctgctccccccatggcccccacaccagcagctcct
acaccggcggcccctgcaccagccccctcctggcccctgtcatcctctgtcccttcccag
aaaacctaccatggcagctacggtttccgtctgggcttcctgcattctggaacagccaag
tctgtgacttgcacgtactcccctgacctcaacaagatgttttgccagctggccaagacc
tgccccgtgcagctatgggttgattccacacccccacccggcagccgcgtccgcgccatg
gccatctacaagcagtcacagcacatgacggaggtcgtgaggcgctgcccccaccatgag
cgctgctcagacagcgatggactggcccctcctcagcaccttatccgagtggaaggaaat
ttgcgtgtggagtattcggatgacagaaacacttttcgacatagtgtggtggtgccctat
gagccgcctgaggttggctctgactgtaccaccatccactacaactacatgtgtaacagt
tcctgcatgggcggcatgaaccggaggcccatccttaccattatcacactggaagactcc
agtggtaatctactgggacggaacagctttgaggtgcgagtttgtgcctgtcctgggaga
gaccggcgcacagaggaagagaatttccgcaagaaaggggagccttgccaccagctgccc
cctgggagcactaagcgagcactgcccaacaacaccagctcctctccccagccaaagaag
aaaccactggatggagaatatttcacccttcagatccgtgggcgtgagcgcttcgagatg
ttccgagagctgaatgaggccttggaactcaaggatgcccaggctgggaaagagccagcg
gggagcagggctcactccagccacctgaagtccaagaaggggcaatctacctcccgccat
aaaaaattcatgttcaagacagaggggcctgactcagactga

DBGET integrated database retrieval system