KEGG   Macaca mulatta (rhesus monkey): 716258Help
Entry
716258            CDS       T01028                                 

Gene name
MAP3K14
Definition
(RefSeq) mitogen-activated protein kinase kinase kinase 14
  KO
K04466  mitogen-activated protein kinase kinase kinase 14 [EC:2.7.11.25]
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04010  MAPK signaling pathway
mcc04064  NF-kappa B signaling pathway
mcc04210  Apoptosis
mcc04380  Osteoclast differentiation
mcc04625  C-type lectin receptor signaling pathway
mcc04660  T cell receptor signaling pathway
mcc04668  TNF signaling pathway
mcc04672  Intestinal immune network for IgA production
mcc05166  Human T-cell leukemia virus 1 infection
mcc05169  Epstein-Barr virus infection
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    716258 (MAP3K14)
   04064 NF-kappa B signaling pathway
    716258 (MAP3K14)
   04668 TNF signaling pathway
    716258 (MAP3K14)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    716258 (MAP3K14)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    716258 (MAP3K14)
   04660 T cell receptor signaling pathway
    716258 (MAP3K14)
   04672 Intestinal immune network for IgA production
    716258 (MAP3K14)
  09158 Development
   04380 Osteoclast differentiation
    716258 (MAP3K14)
 09160 Human Diseases
  09172 Infectious diseases: Viral
   05166 Human T-cell leukemia virus 1 infection
    716258 (MAP3K14)
   05169 Epstein-Barr virus infection
    716258 (MAP3K14)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mcc01001]
    716258 (MAP3K14)
Enzymes [BR:mcc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.25  mitogen-activated protein kinase kinase kinase
     716258 (MAP3K14)
Protein kinases [BR:mcc01001]
 Serine/threonine kinases: STE group
  Other
   716258 (MAP3K14)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Pkinase_fungal APH
Motif
Other DBs
NCBI-GeneID: 716258
NCBI-ProteinID: NP_001253627
Ensembl: ENSMMUG00000007863
UniProt: F7B742
LinkDB All DBs
Position
16
AA seq 947 aa AA seqDB search
MAVMEMACPGAPGSAVGQQKELPKAKEKTPPLGKKQSSVYKLEAVEKSPVFCGKWEILND
VITKGTAKEGSEAGPAAISIIAQAECENSQEFSPTFSERIFIAGSKQYSQSESLDQIPNN
VAHATEGKMARVCWKGKRRSKARKKRKKKSSKSLAHAGVALAKPLPRTPEQESCTIPVQE
DESPLGAPYVRNTPQFTKPLKEPGLGQLCFKQLGEGLRPALPRSELHKLISPLQCLNHVW
KLHHPQDGGPLPLPTHPFPYSRLPHPFPFHPLQPWKPHPLESFLGKLACVDSQQPLPHPH
LSKLACVDSPKPLPGPHLEPSCPSRGAHEKFSVEEYLVHALQGSVSSGQAHSLTSLAKTW
AAGGSRPREPSPKTEDNEGVLLTEKLKPVDYEYREEVHWATHQPRLGRGSFGEVHRMEDK
QTGFQCAVKKVRLEVFRAEELMACAGLTSPRIVPLYGAVREGPWVNIFMELLEGGSLGQL
VKEQGCLPEDRALYYLGQALEGLEYLHSRRILHGDVKADNVLLSSDGSHAALCDFGHAVC
LQPDGLGKSLLTGDYIPGTETHMAPEVVLGRRCDAKVDVWSSCCMMLHMLNGCHPWTQFF
RGPLCLKIASEPPPVREIPASCAPLTAQAIQEGLKKEPVHRASAAELAGKVNQALQQVGG
LKSPWRGEYKEPRHPPPNQANYHQTLHAQPRELSPRAPEPRPVEETTGRAPKLQPPLPPE
PPEPNKSPPLTLSKEESGMWEPLPLSSLEPAPARNPSSPERKATFPEQELQQLEIELFLN
SLSQPFSLEEQEQILSCLSIDSLSLSDDSEKNPSKASQSSRDTLSSGVHSWSSQAEARSS
SWNMVLARGRPTDTPSYFNGVKVQIQSLNGEHLHIREFHRVKVGDIATGISSQIPAAAFS
LVTKDGQPVRYDMEVPDSGIDLQCMLAPDGSFAWSWRVKHGQLENRP
NT seq 2844 nt NT seq  +upstreamnt  +downstreamnt
atggcagtgatggaaatggcctgcccaggcgcccctggctcagcagtggggcagcagaag
gaactccccaaagccaaggagaagacgccgccactggggaagaaacagagctccgtctac
aagcttgaggccgtggagaagagccctgtgttctgcggaaagtgggagatcctgaacgac
gtgattaccaagggcacagccaaggaaggctccgaggcagggccagctgccatctctatc
atcgcccaggctgagtgtgagaatagccaggagttcagccccaccttttcagaacgcatt
ttcatcgctgggtccaaacagtacagccagtctgagagtcttgatcagatccccaacaat
gtggcccatgctaccgagggcaaaatggcccgtgtgtgttggaagggaaagcgtcgtagc
aaagcccggaagaaacggaagaagaagagctcaaagtccctggctcatgcaggagtggcc
ttggccaaacccctccccaggacccctgagcaggagagctgcaccatcccagtgcaggag
gatgagtctccactcggcgccccatatgtgagaaacaccccgcagttcaccaagcctctg
aaggaaccaggccttggtcaactctgttttaagcagcttggcgagggcctgcgaccagct
ctgcctcgatcggaactccacaaactgatcagccccttgcaatgtctgaaccacgtgtgg
aaactgcaccacccccaggacggaggccccctgcccctgcccacgcaccccttcccctat
agcagactgcctcatcccttcccattccaccctctccagccctggaaacctcaccctcta
gagtccttcctgggcaaactggcctgtgtagacagccagcaacccttgcctcacccacac
ctgagcaaactggcctgtgtagacagtccaaagcccctgcctggcccacacctggagccc
agctgcccatctcgtggtgcccatgagaagttttctgtggaggaatacctggtgcacgct
ctgcaaggcagcgtgagctcaggccaggcccacagcctgaccagcctggccaagacctgg
gcagcagggggctccagaccccgggagcccagccccaaaactgaggacaatgagggcgtc
ctgctcactgagaaactcaagccagtggattatgagtaccgagaagaagtccactgggcc
acacaccagccccgcctgggcagaggctccttcggagaggtgcacaggatggaggacaag
cagactggcttccagtgcgctgtcaaaaaggtgcggctggaagtatttcgggcggaggaa
ctgatggcatgtgcaggattgacctcacccagaattgtccctttgtatggagctgtgagg
gaagggccttgggtcaacatcttcatggagctgctggaaggtggctccctgggccagctg
gtcaaggagcagggctgtctcccagaggaccgggccctctactacctgggccaggccctg
gaggggctggaatacctccactcacgaaggattctgcatggggacgtcaaagcggacaac
gtgctcctgtccagcgatgggagccatgcagccctctgcgactttggccatgctgtgtgt
cttcaacctgatggcctggggaagtccttgctcacaggggactacatccctggcacagag
acccacatggctccggaggtggtgttgggcaggcgctgcgacgccaaggtggacgtctgg
agcagctgctgcatgatgctgcacatgctcaacggctgccacccctggactcagttcttc
cgagggccgctctgcctcaagattgccagcgagcctccgcctgtgagggagatcccagcc
tcctgtgcccctctcacagcccaggccatccaagaggggctgaagaaagagcccgtccac
cgcgcgtctgcagcggagctggcagggaaggtgaaccaggcactacagcaagtgggaggt
ctgaagagcccttggaggggagaatataaagaaccaagacatccaccaccaaatcaagcc
aattatcaccagaccctccatgcccagccgagggagctttcgccaagggccccagagcct
cggccagttgaggagacaacaggcagagcccctaagctccagcctcctctcccaccagag
cccccagagccaaacaagtctcctcccttgactttgagcaaggaggagtctgggatgtgg
gaacccttacctctgtcttccctggagccagcccctgccagaaaccccagctcaccagag
cggaaagcaaccttcccggagcaggaactgcagcagctggaaatagaattattcctgaac
agcctgtcccagccattttctctggaggagcaggagcaaattctctcgtgcctcagcatc
gacagcctctccctgtcggatgacagcgagaagaacccatcaaaggcctctcaaagctcg
cgggacaccctgagctcaggcgtacactcctggagcagccaggccgaggctcgaagctcc
agctggaacatggtgctggcccgggggcggcccaccgacaccccaagctatttcaatggt
gtgaaagtccaaatacagtctctcaatggtgaacacctgcacatccgggagttccaccgg
gtcaaagtgggagacatcgccactggcatcagcagccagatcccagccgcagccttcagc
ttggtgaccaaagatgggcagcctgttcgctatgacatggaggtgccagactcgggcatc
gacctgcagtgcatgctggcccctgatggcagcttcgcctggagctggagggtcaagcat
ggccagctggagaacaggccctaa

DBGET integrated database retrieval system