KEGG   Macaca mulatta (rhesus monkey): 716452
Entry
716452            CDS       T01028                                 

Gene name
JUN
Definition
(RefSeq) transcription factor AP-1
  KO
K04448  transcription factor AP-1
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc01522  Endocrine resistance
mcc04010  MAPK signaling pathway
mcc04012  ErbB signaling pathway
mcc04024  cAMP signaling pathway
mcc04137  Mitophagy - animal
mcc04210  Apoptosis
mcc04310  Wnt signaling pathway
mcc04380  Osteoclast differentiation
mcc04510  Focal adhesion
mcc04530  Tight junction
mcc04620  Toll-like receptor signaling pathway
mcc04621  NOD-like receptor signaling pathway
mcc04625  C-type lectin receptor signaling pathway
mcc04657  IL-17 signaling pathway
mcc04658  Th1 and Th2 cell differentiation
mcc04659  Th17 cell differentiation
mcc04660  T cell receptor signaling pathway
mcc04662  B cell receptor signaling pathway
mcc04668  TNF signaling pathway
mcc04722  Neurotrophin signaling pathway
mcc04912  GnRH signaling pathway
mcc04915  Estrogen signaling pathway
mcc04921  Oxytocin signaling pathway
mcc04926  Relaxin signaling pathway
mcc04932  Non-alcoholic fatty liver disease
mcc04933  AGE-RAGE signaling pathway in diabetic complications
mcc05030  Cocaine addiction
mcc05031  Amphetamine addiction
mcc05132  Salmonella infection
mcc05133  Pertussis
mcc05135  Yersinia infection
mcc05140  Leishmaniasis
mcc05142  Chagas disease
mcc05161  Hepatitis B
mcc05162  Measles
mcc05166  Human T-cell leukemia virus 1 infection
mcc05167  Kaposi sarcoma-associated herpesvirus infection
mcc05169  Epstein-Barr virus infection
mcc05170  Human immunodeficiency virus 1 infection
mcc05171  Coronavirus disease - COVID-19
mcc05200  Pathways in cancer
mcc05203  Viral carcinogenesis
mcc05210  Colorectal cancer
mcc05211  Renal cell carcinoma
mcc05224  Breast cancer
mcc05231  Choline metabolism in cancer
mcc05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
mcc05321  Inflammatory bowel disease
mcc05323  Rheumatoid arthritis
mcc05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    716452 (JUN)
   04012 ErbB signaling pathway
    716452 (JUN)
   04310 Wnt signaling pathway
    716452 (JUN)
   04668 TNF signaling pathway
    716452 (JUN)
   04024 cAMP signaling pathway
    716452 (JUN)
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    716452 (JUN)
  09143 Cell growth and death
   04210 Apoptosis
    716452 (JUN)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    716452 (JUN)
   04530 Tight junction
    716452 (JUN)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    716452 (JUN)
   04621 NOD-like receptor signaling pathway
    716452 (JUN)
   04625 C-type lectin receptor signaling pathway
    716452 (JUN)
   04660 T cell receptor signaling pathway
    716452 (JUN)
   04658 Th1 and Th2 cell differentiation
    716452 (JUN)
   04659 Th17 cell differentiation
    716452 (JUN)
   04657 IL-17 signaling pathway
    716452 (JUN)
   04662 B cell receptor signaling pathway
    716452 (JUN)
  09152 Endocrine system
   04912 GnRH signaling pathway
    716452 (JUN)
   04915 Estrogen signaling pathway
    716452 (JUN)
   04921 Oxytocin signaling pathway
    716452 (JUN)
   04926 Relaxin signaling pathway
    716452 (JUN)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    716452 (JUN)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    716452 (JUN)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    716452 (JUN)
   05203 Viral carcinogenesis
    716452 (JUN)
   05231 Choline metabolism in cancer
    716452 (JUN)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    716452 (JUN)
  09162 Cancer: specific types
   05210 Colorectal cancer
    716452 (JUN)
   05211 Renal cell carcinoma
    716452 (JUN)
   05224 Breast cancer
    716452 (JUN)
  09163 Immune disease
   05323 Rheumatoid arthritis
    716452 (JUN)
   05321 Inflammatory bowel disease
    716452 (JUN)
  09165 Substance dependence
   05030 Cocaine addiction
    716452 (JUN)
   05031 Amphetamine addiction
    716452 (JUN)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    716452 (JUN)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    716452 (JUN)
   04933 AGE-RAGE signaling pathway in diabetic complications
    716452 (JUN)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    716452 (JUN)
   05135 Yersinia infection
    716452 (JUN)
   05133 Pertussis
    716452 (JUN)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    716452 (JUN)
   05170 Human immunodeficiency virus 1 infection
    716452 (JUN)
   05161 Hepatitis B
    716452 (JUN)
   05171 Coronavirus disease - COVID-19
    716452 (JUN)
   05162 Measles
    716452 (JUN)
   05167 Kaposi sarcoma-associated herpesvirus infection
    716452 (JUN)
   05169 Epstein-Barr virus infection
    716452 (JUN)
  09174 Infectious disease: parasitic
   05140 Leishmaniasis
    716452 (JUN)
   05142 Chagas disease
    716452 (JUN)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    716452 (JUN)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mcc03000]
    716452 (JUN)
Transcription factors [BR:mcc03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   AP-1(-like) components, Jun
    716452 (JUN)
SSDB
Motif
Pfam: Jun bZIP_1 bZIP_2 bZIP_Maf ZapB PspA_IM30 Fib_alpha FlaC_arch NBP1 TFIIA Jnk-SapK_ap_N DUF3450
Other DBs
NCBI-GeneID: 716452
NCBI-ProteinID: NP_001252779
UniProt: F7A6Z1 G7MHA3
LinkDB
Position
1
AA seq 334 aa
MTAKMETTFYDDALNASFLPSESGAYGYSNPKILKQSMTLNLADPVGSLKPHLRAKNSDL
LTSPDVGLLKLASPELERLIIQSSNGHITTTPTPTQFLCPKNVTDEQEGFAEGFVRALAE
LHSQNTLPSVTSAAQPVSGAGMVAPAVASVAGGSGSGGFSASLHSEPPVYANLSNFNPGA
LSSGGGAPSYGAAGLAFPAQPQQQQPPPQPPHHLPQQMPVQHPRLQALKEEPQTVPEMPG
ETPPLSPIDMESQERIKAERKRMRNRIAASKCRKRKLERIARLEEKVKTLKAQNSELAST
ANMLREQVAQLKQKVMNHVNSGCQLMLTQQLQTF
NT seq 1005 nt   +upstreamnt  +downstreamnt
atgactgcaaagatggaaacgaccttctatgatgatgccctcaacgcctcgttcctcccg
tccgagagcggagcttatggctacagtaaccccaagatcctgaaacagagcatgaccctg
aacctggccgacccagtggggagcctgaagccgcacctccgcgccaagaactcggacctc
ctcacctcgcccgacgtggggctgctcaagctggcgtcgcccgagctggagcgcctgata
atccagtccagcaacgggcacatcaccaccacgccgacccccacccagttcctgtgcccc
aagaacgtgacagacgagcaggagggcttcgccgagggcttcgtgcgcgccctggccgaa
ctgcacagccagaacacgctgcccagcgtcacgtcagcggcgcagccggtcagcggggcg
ggcatggtagctccagcggtagcctcggtggcagggggcagcggcagcggaggcttcagc
gccagcctgcacagcgagccgcccgtctacgccaacctcagcaacttcaacccaggcgcg
ctgagcagcggcggcggggcgccctcctacggcgcggccggcctggcctttcccgcgcaa
ccccagcagcagcagccgccgccgcagccgccgcaccacctgccccagcagatgcccgtg
cagcacccgcggctgcaagccctgaaggaggagcctcagacagtgcccgagatgcctggc
gagacgccgcccctgtcccccattgacatggagtcccaggagcggatcaaggcggagagg
aagcgtatgaggaaccgcattgctgcctccaagtgccgaaaaaggaagctggagagaatc
gcccggctggaggaaaaagtgaaaaccttgaaagctcagaactcggagctggcgtccacg
gccaacatgctcagggaacaggtggcacagcttaaacagaaagtcatgaaccacgttaac
agtgggtgccaactcatgctaacgcagcagttgcaaacattttga

DBGET integrated database retrieval system