KEGG   Macaca mulatta (rhesus monkey): 716671Help
Entry
716671            CDS       T01028                                 

Gene name
PTGS2, PGHS2
Definition
(RefSeq) prostaglandin-endoperoxide synthase 2
  KO
K11987  prostaglandin-endoperoxide synthase 2 [EC:1.14.99.1]
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc00590  Arachidonic acid metabolism
mcc01100  Metabolic pathways
mcc04064  NF-kappa B signaling pathway
mcc04370  VEGF signaling pathway
mcc04625  C-type lectin receptor signaling pathway
mcc04657  IL-17 signaling pathway
mcc04668  TNF signaling pathway
mcc04723  Retrograde endocannabinoid signaling
mcc04726  Serotonergic synapse
mcc04913  Ovarian steroidogenesis
mcc04921  Oxytocin signaling pathway
mcc04923  Regulation of lipolysis in adipocytes
mcc05140  Leishmaniasis
mcc05163  Human cytomegalovirus infection
mcc05165  Human papillomavirus infection
mcc05167  Kaposi sarcoma-associated herpesvirus infection
mcc05200  Pathways in cancer
mcc05204  Chemical carcinogenesis
mcc05206  MicroRNAs in cancer
mcc05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    716671 (PTGS2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04370 VEGF signaling pathway
    716671 (PTGS2)
   04064 NF-kappa B signaling pathway
    716671 (PTGS2)
   04668 TNF signaling pathway
    716671 (PTGS2)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    716671 (PTGS2)
   04657 IL-17 signaling pathway
    716671 (PTGS2)
  09152 Endocrine system
   04923 Regulation of lipolysis in adipocyte
    716671 (PTGS2)
   04913 Ovarian Steroidogenesis
    716671 (PTGS2)
   04921 Oxytocin signaling pathway
    716671 (PTGS2)
  09156 Nervous system
   04726 Serotonergic synapse
    716671 (PTGS2)
   04723 Retrograde endocannabinoid signaling
    716671 (PTGS2)
 09160 Human Diseases
  09161 Cancers
   05200 Pathways in cancer
    716671 (PTGS2)
   05206 MicroRNAs in cancer
    716671 (PTGS2)
   05204 Chemical carcinogenesis
    716671 (PTGS2)
   05222 Small cell lung cancer
    716671 (PTGS2)
  09167 Infectious diseases
   05163 Human cytomegalovirus infection
    716671 (PTGS2)
   05167 Kaposi sarcoma-associated herpesvirus infection
    716671 (PTGS2)
   05165 Human papillomavirus infection
    716671 (PTGS2)
   05140 Leishmaniasis
    716671 (PTGS2)
Enzymes [BR:mcc01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.99  Miscellaneous
    1.14.99.1  prostaglandin-endoperoxide synthase
     716671 (PTGS2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: An_peroxidase EGF
Motif
Other DBs
NCBI-GeneID: 716671
NCBI-ProteinID: XP_001107538
Ensembl: ENSMMUG00000016857
UniProt: G7MF20
LinkDB All DBs
Position
1
AA seq 604 aa AA seqDB search
MLARALLLCAVLALGHAANPCCSYPCQNRGVCMSVGFDQYKCDCTRTGFYGENCSTPEFL
TRIKLLLKPTPNTVHYILTHFKGFWNVVNNIPFLRNAIMSYVLTSRSHLIDSPPTYNADY
GYKSWEAFSNLSYYTRALPPVPDDCPTPLGVKGKKQLPDSNEIVEKFLLRRKFIPDPQGT
NMMFAFFAQHFTHQFFKTDHKRGPAFTKGLGHGVDLNHIYGETLDRQHKLRLFKDGKMKY
QIIDGEMYPPTVKDTQAEMIYPPQVPEHLRFAVGQEVFGLVPGLMMYATIWLREHNRVCD
VLKQEHPEWGDEQLFQTSRLILIGETIKIVIEDYVQHLSGYHFKLKFDPELLFNKQFQYQ
NRIAAEFNTLYHWHPLLPDNFQIHDQKYNYQQFIYNNSILLEHGITQFVESFTRQIAGRV
AGGRNVPPAVQKVSQASIDQSRQMKYQSFNEYRKRFMLKPYESFEELTGEKEMSAELEAL
YGDIDAVELYPALLVEKPRPDAIFGETMVEVGAPFSLKGLMGNVICSPAYWKPSTFGGEV
GFQIINTASIQSLICNNVKGCPFTSFSVPDPELIKTVTINASSSRSRLDDINPTVLLKER
STEL
NT seq 1815 nt NT seq  +upstreamnt  +downstreamnt
atgctcgcccgcgccctgctgctgtgcgcagtcctggcactcggccacgcagcaaatcct
tgctgttcctacccatgtcaaaaccgaggtgtatgtatgagtgtgggatttgaccaatat
aagtgcgattgtacccggacaggattctatggtgaaaactgctcaacaccggaatttctg
acaagaataaaattacttctgaaacccactccaaacacagtgcactacatacttacccac
ttcaagggattttggaacgttgtgaataacattcccttccttcgaaatgcaattatgagt
tatgtgttgacgtccagatcacatttgattgacagtccaccaacttacaatgctgactat
ggctacaaaagctgggaagccttctctaacctctcctattataccagagcccttcctcct
gtgcctgatgactgcccaactcccttgggtgtgaaaggtaagaagcagcttcctgattca
aatgagattgtggaaaaatttcttctaagaagaaagttcatccctgatccccagggcaca
aacatgatgtttgcattctttgcccagcacttcacgcatcagtttttcaagacagatcat
aagcgagggccagctttcaccaaagggctgggccatggggtggacttaaatcatatttat
ggtgaaactctggatagacagcataaactgcgccttttcaaggatggaaaaatgaaatat
cagataattgatggagagatgtatcctcccacagtcaaagatactcaggcagagatgatc
taccctcctcaagtccctgagcatctgcggtttgctgtggggcaggaggtctttggtctg
gtgcctggtctgatgatgtatgccacaatctggctgcgagaacacaacagagtgtgcgat
gtgcttaaacaggagcatccggaatggggtgatgagcagttgttccagacaagcaggcta
atactgataggagagactattaagattgtgattgaagattatgtacaacacttgagtggc
tatcacttcaaactgaaatttgacccagaactacttttcaacaaacaattccagtaccaa
aatcgtattgctgctgagtttaacaccctctatcactggcatccccttctgcctgacaac
tttcaaattcatgaccagaaatacaactatcaacagtttatctacaacaactctatatta
ctggaacatggaattacccagtttgttgaatcattcaccaggcaaattgctggcagggtt
gctggtggtaggaatgttccacccgcagtacaaaaagtatcacaggcttccattgaccag
agcaggcagatgaaataccagtcttttaatgagtaccgcaaacgctttatgctgaagccc
tatgaatcatttgaagaacttacaggagaaaaggaaatgtctgcagagttggaagcactc
tatggtgacatcgatgctgtggagctgtatcctgcccttctggtagaaaagcctcgtcca
gatgccatctttggtgagaccatggtagaagttggagcaccgttctccttgaaaggactt
atgggtaatgttatatgttctcctgcctactggaagccaagcacttttggtggagaagtg
ggttttcaaatcatcaacactgcctcaattcagtctctcatctgcaataacgtgaagggc
tgtccctttacttcattcagtgttccagatccagagctcatcaaaacagttaccatcaat
gcaagttcttctcgctccagactagatgatatcaatcccacagtactactaaaagaacgt
tcaactgaactgtag

DBGET integrated database retrieval system