KEGG   Macaca mulatta (rhesus monkey): 716690
Entry
716690            CDS       T01028                                 

Gene name
IL6R
Definition
(RefSeq) interleukin-6 receptor subunit alpha isoform X2
  KO
K05055  interleukin 6 receptor
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc01521  EGFR tyrosine kinase inhibitor resistance
mcc04060  Cytokine-cytokine receptor interaction
mcc04061  Viral protein interaction with cytokine and cytokine receptor
mcc04066  HIF-1 signaling pathway
mcc04151  PI3K-Akt signaling pathway
mcc04630  JAK-STAT signaling pathway
mcc04640  Hematopoietic cell lineage
mcc04659  Th17 cell differentiation
mcc04932  Non-alcoholic fatty liver disease
mcc05163  Human cytomegalovirus infection
mcc05171  Coronavirus disease - COVID-19
mcc05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    716690 (IL6R)
   04066 HIF-1 signaling pathway
    716690 (IL6R)
   04151 PI3K-Akt signaling pathway
    716690 (IL6R)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    716690 (IL6R)
   04061 Viral protein interaction with cytokine and cytokine receptor
    716690 (IL6R)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    716690 (IL6R)
   04659 Th17 cell differentiation
    716690 (IL6R)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    716690 (IL6R)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    716690 (IL6R)
  09172 Infectious disease: viral
   05171 Coronavirus disease - COVID-19
    716690 (IL6R)
   05163 Human cytomegalovirus infection
    716690 (IL6R)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    716690 (IL6R)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:mcc04050]
    716690 (IL6R)
   04090 CD molecules [BR:mcc04090]
    716690 (IL6R)
Cytokine receptors [BR:mcc04050]
 Interleukin receptor families
  IL6/12 receptor family
   716690 (IL6R)
CD molecules [BR:mcc04090]
 Proteins
  716690 (IL6R)
SSDB
Motif
Pfam: IL6Ra-bind Ig_3 ig Ig_2 fn3
Other DBs
NCBI-GeneID: 716690
NCBI-ProteinID: XP_001114404
UniProt: A0A5F8AUE5
LinkDB
Position
1
AA seq 697 aa
MPKPHPRPMKSESLEPRPRHWWVLGLPADSSGQPGYQALLYHRGKSHIASSRALQVCLSQ
RNPVHETKNQNKCPFLINRTGRKGSDGAGGPLFSPLRCGAVAGSHPLGRPVRGAVAPSAP
AFVTAPWDGPETLQREFLKCFPVLPGPSAALSHVRVGSLTDTETGQRERSRARRGAEGLA
VYIERRAPANGGCPRRLSQPARPPPRPCRPVPTSLSASAGPWSGSRGGSMLAVGCALLAA
LLAAPGAALAPGGCPAQEVARGVLTSLPGDSVTLTCPGGEPEDNATVHWVLRKPAVGSHL
SRWAGVGRRLLLRSVQLHDSGNYSCYRAGRPAGTVHLLVDVPPEEPQLSCFRKSPLSNVV
CEWGPRSTPSPTTKAVLLVRKFQNSPAEDFQEPCQYSQESQKFSCQLAVPEGDSSFYIVS
MCVASSVGSKLSKTQTFQGCGILQPDPPANITVTAVARNPRWLSVTWQDPHSWNSSFYRL
RFELRYRAERSKTFTTWMVKDLQHHCVIHDAWSGLRHVVQLRAQEEFGQGEWSEWSPEAM
GTPWTESRSPPAENEVSTPTQAPTTNKDDDNILSRDSANATSLPVQDSSSVPLPTFLVAG
GSLAFGTLLCIAIVLRFKKTWKLRALKEGKTSMHPPYSLGQLVPERPRPTPVLVPLISPP
VSPSSLGSDNTSSHNRPDARDPRSPYDISNTDYFFPR
NT seq 2094 nt   +upstreamnt  +downstreamnt
atgcccaagcctcaccccagaccgatgaaatcagaatctctggagccccgaccgagacat
tggtgggttttggggctcccggctgattccagtgggcaaccaggctaccaagcactgctt
tatcataggggtaagagtcacatcgcctcctcgagggctctccaggtgtgcctttcacag
cgtaatcctgttcacgaaaccaaaaatcaaaacaagtgcccttttctcatcaacagaacc
gggaggaagggctctgacggggctggcggtcccctgttctccccgctcaggtgcggcgct
gtggcaggaagccaccccctcggtcggccggtgcgcggggctgttgcgccatccgctcca
gctttcgtaaccgcaccctgggacggcccagagacgctccagcgcgagttcctcaaatgt
tttcctgtgttgccaggaccgtccgccgctctgagtcatgtgcgagtgggaagtctcact
gacactgagaccggccagagggagcggagccgagcgcggcgcggggctgagggactcgca
gtgtatatagagcgccgggctcctgcgaatgggggctgcccccggagactgagccagcct
gcccgcccaccgccccgcccctgccgcccggttcccaccagcctgtccgcttctgcggga
ccatggagcggtagccgaggaggaagcatgctggccgtcggctgcgcgctgctggctgcc
ctgctggccgcgccgggggcggcgctggccccggggggctgccctgcgcaggaggtggcg
agaggtgtgctgaccagtctgccaggagacagcgtgactctgacctgcccagggggagag
ccggaagacaatgccactgttcactgggttctcaggaagccagctgtaggctcccacctc
agcagatgggctggcgtgggaaggaggctgctgctgaggtcggtgcagctccatgactct
ggaaactattcatgctaccgggccggccgcccggctggaactgtgcacttgctggtggat
gttccccccgaggagccccagctctcctgcttccggaagagccccctcagcaacgttgtt
tgtgagtggggtcctcggagcaccccatctccgacgaccaaggctgtgctgttggtgagg
aagtttcagaacagtccggccgaagacttccaggagccgtgccagtattcccaggagtcc
cagaagttctcctgccagttggcagtcccggagggagacagctctttctacatagtgtcc
atgtgcgtcgccagtagtgtcgggagcaagctcagcaaaactcagacctttcagggttgt
ggaatcttgcagcctgatccgcctgccaacatcacagtcactgccgtggccagaaacccc
cgctggctcagtgtcacctggcaagacccccactcctggaactcatctttctacagacta
cggtttgagctcagatatcgagctgaacggtcaaagacattcacaacatggatggtcaag
gacctccagcatcactgtgtcatccacgacgcctggagcggcctgaggcacgtggtgcag
cttcgtgcccaggaggagttcgggcaaggcgagtggagcgagtggagcccggaggccatg
ggcacgccttggacagaatccaggagtcctccagctgagaacgaggtgtccacccccacg
caggcacctactactaataaagatgatgataatattctctccagagattctgcaaatgcg
acaagcctcccagtgcaagattcttcttcggtaccactgcccacattcctggttgctgga
gggagcctggcgttcggaacgctcctgtgcattgccattgttctgaggttcaagaagacg
tggaagctgcgggctctgaaggaaggcaagacaagcatgcacccgccgtattctttgggg
cagctggtcccagagaggccgcgacccaccccagtgcttgttcctctcatctccccacca
gtgtcccccagcagcctggggtctgacaacacctcgagccacaaccgaccagatgccagg
gacccacggagcccttacgacatcagcaatacagactacttcttccccagatag

DBGET integrated database retrieval system