KEGG   Macaca mulatta (rhesus monkey): 716907
Entry
716907            CDS       T01028                                 

Gene name
TRAF6
Definition
(RefSeq) TNF receptor-associated factor 6
  KO
K03175  TNF receptor-associated factor 6 [EC:2.3.2.27]
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04010  MAPK signaling pathway
mcc04064  NF-kappa B signaling pathway
mcc04120  Ubiquitin mediated proteolysis
mcc04140  Autophagy - animal
mcc04144  Endocytosis
mcc04380  Osteoclast differentiation
mcc04620  Toll-like receptor signaling pathway
mcc04621  NOD-like receptor signaling pathway
mcc04622  RIG-I-like receptor signaling pathway
mcc04657  IL-17 signaling pathway
mcc04722  Neurotrophin signaling pathway
mcc05132  Salmonella infection
mcc05133  Pertussis
mcc05135  Yersinia infection
mcc05140  Leishmaniasis
mcc05142  Chagas disease
mcc05145  Toxoplasmosis
mcc05152  Tuberculosis
mcc05160  Hepatitis C
mcc05161  Hepatitis B
mcc05162  Measles
mcc05168  Herpes simplex virus 1 infection
mcc05169  Epstein-Barr virus infection
mcc05170  Human immunodeficiency virus 1 infection
mcc05171  Coronavirus disease - COVID-19
mcc05200  Pathways in cancer
mcc05222  Small cell lung cancer
mcc05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    716907 (TRAF6)
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    716907 (TRAF6)
   04064 NF-kappa B signaling pathway
    716907 (TRAF6)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    716907 (TRAF6)
   04140 Autophagy - animal
    716907 (TRAF6)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    716907 (TRAF6)
   04621 NOD-like receptor signaling pathway
    716907 (TRAF6)
   04622 RIG-I-like receptor signaling pathway
    716907 (TRAF6)
   04657 IL-17 signaling pathway
    716907 (TRAF6)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    716907 (TRAF6)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    716907 (TRAF6)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    716907 (TRAF6)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    716907 (TRAF6)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    716907 (TRAF6)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    716907 (TRAF6)
   05135 Yersinia infection
    716907 (TRAF6)
   05133 Pertussis
    716907 (TRAF6)
   05152 Tuberculosis
    716907 (TRAF6)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    716907 (TRAF6)
   05161 Hepatitis B
    716907 (TRAF6)
   05160 Hepatitis C
    716907 (TRAF6)
   05171 Coronavirus disease - COVID-19
    716907 (TRAF6)
   05162 Measles
    716907 (TRAF6)
   05168 Herpes simplex virus 1 infection
    716907 (TRAF6)
   05169 Epstein-Barr virus infection
    716907 (TRAF6)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    716907 (TRAF6)
   05140 Leishmaniasis
    716907 (TRAF6)
   05142 Chagas disease
    716907 (TRAF6)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mcc04131]
    716907 (TRAF6)
   04121 Ubiquitin system [BR:mcc04121]
    716907 (TRAF6)
Enzymes [BR:mcc01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     716907 (TRAF6)
Membrane trafficking [BR:mcc04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Ubiquitin E3 ligases
    716907 (TRAF6)
Ubiquitin system [BR:mcc04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   TRAF proteins
    716907 (TRAF6)
SSDB
Motif
Pfam: zf-TRAF TRAF6_Z2 zf-C3HC4_2 zf-C3HC4 zf-C3HC4_3 zf-RING_2 zf-RING_UBOX zf-C3HC4_4 zf-TRAF_2 zf-RING_5 SlyX Spc29 U-box zf-RING_11 Tropomyosin_1 DUF16 PspA_IM30 AAA_13 EzrA FliJ ADIP UPF0242 DUF3450 TMF_DNA_bd CENP-F_leu_zip Filament Spc7 Sina DUF1664 DivIC
Other DBs
NCBI-GeneID: 716907
NCBI-ProteinID: NP_001129268
Ensembl: ENSMMUG00000018266
UniProt: B6CJY5 F7HMD7
LinkDB
Position
14
AA seq 522 aa
MSLLNCENSCGSSQSESDCCVAMASSCSAATKDDSVGGTASTGNLSSSFMEDIQGYDVEF
DPPLESKYECPICLMALREAVQTPCGHRFCKACIIKSIRDAGHKCPVDNEILLENQLFPD
NFAKREILSLMVKCPNEGCLHKMELRHLEDHQAHCEFALVDCPQCQRPFQKFHINIHILK
DCPRRQVSCDNCAALVAFEDKEIHDQNCPLANVICEYCNTILIREQMPNHYDLDCPTAPI
PCTFSTFGCHEKMQRNHLARHLQENTQSHMRMLAQAVHSLSLIPDSGYVSEVRNFQETIH
QLEGRLVRQDHQIRELTAKMETQSTYVSELKRTIRTLEDKVAEIEAQQCNGIYIWKIGNF
GMHLKCQEEEKPVVIHSPGFYTGKPGYKLCMRLHLQLPTAQRCANYISLFVHTMQGEYDS
HLPWPFQGTIRLTILDQSEAPVRQNHEEIMDAKPDLLAFQRPTIPRNPKGFGYVTFMHLE
ALRQRTFIKDDTLLVRCEVSTRFDMGSLRREGFQPRSTDSGV
NT seq 1569 nt   +upstreamnt  +downstreamnt
atgagtctgctaaactgtgaaaacagctgtggatccagccagtctgaaagtgactgctgt
gtggccatggccagctcctgtagcgctgcaacaaaagatgatagtgtgggtggaactgcc
agcacgggaaacctctccagctcatttatggaggacatccagggatatgatgtagagttt
gacccacccctggaaagcaagtacgaatgccccatctgcttgatggcactacgagaagca
gtgcaaacaccatgcggccataggttctgcaaagcctgcatcataaaatcaataagggat
gcaggtcacaaatgtccagttgacaatgaaatactgctggaaaatcaactatttccagac
aattttgcaaaacgtgagattctttctctgatggtgaagtgtccaaatgaaggttgtttg
cataagatggaactgaggcatcttgaggatcatcaagcacattgtgagtttgctcttgtg
gattgtccccaatgccaacgtcccttccaaaaattccatattaatattcacattctgaag
gattgtccaaggagacaggtttcttgtgacaactgtgctgcattagtggcatttgaagat
aaagagatccatgaccagaactgtcctttggcaaatgtcatctgtgaatactgcaatact
atactcatcagagaacagatgcctaatcattatgatctagactgccctacagctccaatt
ccatgcacattcagtacttttggttgccatgaaaagatgcagagaaatcacttggcacgc
cacctacaagagaacacccagtcacacatgagaatgttggcccaggctgttcatagtttg
agccttatacccgactctgggtatgtctcagaggtccggaatttccaggaaactatccac
cagttagagggtcgccttgtaagacaagaccatcaaatccgggagctgactgctaaaatg
gaaactcagagtacgtatgtaagtgagctcaaacgaaccattcgaacccttgaggacaaa
gttgctgaaattgaagcacagcagtgcaatggaatttacatttggaagattggcaacttt
ggaatgcatttgaaatgtcaagaagaggagaaacctgttgtgattcatagccctgggttc
tacacaggcaaacccgggtacaaactctgcatgcgcttgcaccttcagttaccgactgct
cagcgctgtgcgaactatatatccctttttgtccacacgatgcaaggagagtatgacagc
cacctcccttggcccttccagggtacaatacgccttacaattcttgatcagtccgaagca
cctgtaaggcaaaaccatgaagagataatggatgccaaaccagacctgcttgctttccag
cgacccacaatcccacggaacccaaaaggttttggctatgtaactttcatgcatctggaa
gccctaagacaaagaaccttcattaaggatgacacattattagtgcgctgtgaggtctcc
acccgctttgacatgggtagccttcggagggagggttttcagccacgaagtactgattca
ggggtgtag

DBGET integrated database retrieval system